Gesellschaft zur Stärkung der Verben

Öffentliche Bretter => Omnia licent => Thema gestartet von: katakura am 2012-10-22, 17:49:09

Titel: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-22, 17:49:09
... in der huff, dass hier bald die umfangreichen berichte und bildstrecken zur marburger perVers folgen, sei schon einmal dieser faden eronffen ... ohne einem der berichterstattenden (wohl hauptsalch kilian und güga) vorgreifen zu wollen, sei hiermit schon einmal festgestollen, dass marburg wohl die perVers mit dem besten wetter, den meisten stufen und den weitestgeriesenen gästen war ...

... mir hat's auf alle fälle riesigen spaß gemuchen, zudem beim allfälligen blödeln viele neue, tolle und weltbewegende (jaha! wartet nur den bericht des geliebten sprachführers ab!) ideen das licht diverser gaststätten erblaken und überaus reizvolle ämter vergeben wurden ...

... mein persolnes fazit: marburg war definitiv eine reise und eine perVers wert, und wer's verpossen hat, isset selber daran schuld :D
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-22, 18:18:24
(...) marburg wohl die perVers mit (...) den weitestgeriesenen gästen war ... (...)

Chwomulg sogar aus - Japan - ?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-23, 10:46:24
So will ich denn mit der Schirld des Verlaufs der XV. PerVers beginnen:

6:46 am 19.10. erfolgreiches Shangaien des Karsten Fleischer am Bahnhof Essen-Kupferdreh. Fahrt A40 - A45 - B255 Richtung Marburg.
10:15 Akunft unterhalb des Schlosses, Abstull des Autos in für Flachländer dramatischer Stiele.
Abwurf meines Gepäckes in der 'Sonne' am  Markt.
Marsch Richtung Bahnhof zum Zwecke des Ku-u.-Günter-Empfangs. Erste Gelegenheit zu kurzer Flüssik-Aufnahme in einem Café (Kaffee!) Erste Bilanz hinsilcht der zu beobachtenden Physiognomie der eingeborenen Bevölkerung - partiell niederschmetternd.
11:49 Ku-Zug läuft ein und spuckt unseren Freund auf den Bahnsteig. Günter betritt selbigen zur gleichen Sekunde.
Marsch zurück Richtung Markt; unterwegs Gepäckabwurf in Karstens Bleibe.
Erstes und zwotes Rettungsbier auf dem Marktplatz (Radeberger). Lockerer Gang Barfüßer Straße hinab zum 'Kostbar'; Stärkung vermittels reichhaltiger Käseplatten (Ku und meine Wenik) sowie Suppen (Karsten und Günter) - diverse Biere.
Gemülter Gang Richtung Wettergasse/Reitgasse, Entern des '5 Jahreszeiten' mit herrlicher Terrasse und erhabenem Blick auf den weniger schönen Teil Marburgs.
SMS an Homer und Rebecca, Anwort folgt. Kurz darauf stoßen die Mannheimer dazu.
Angeregtes Plaudern bis ca. 17:15. Gemeinsamer Marsch zu Bahnhof (durch Lahn-Auen). Dortselbst 18:03 Empfang Kilianens, Jennys und Katakurens. Weg zurück zur 'Sonne', um das gemeinsame Abendmahl zu begehen, zu dem auch Stefan - eine Freund Günters - (sehr netter Kerl, der Stefan) erschienen ist.
Ab hier dürfen jene weitererzählen, die so fleißig protokolloren haben.
Noch ein Wort: die Märsche hin und zurück klingen hier so einfach, waren sie aber nicht, wenn man bedenkt, daß zwischen dem Bahnhof und der 'Sonne' ca. 20.000 Höhenmeter über Kopfsteinpflaster zu bewältigen sind! 
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-23, 16:37:11
(...)
Noch ein Wort: die Märsche hin und zurück klingen hier so einfach, waren sie aber nicht, wenn man bedenkt, daß zwischen dem Bahnhof und der 'Sonne' ca. 20.000 Höhenmeter über Kopfsteinpflaster zu bewältigen sind!

(Ca.) 20.000 Höhenmeter!!
Wie hätte ich mich abgoschwontz!!
Felix Baumgartner hatte wägnstens seinen Heliumballon.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-24, 12:49:25
Schon auf dem Marsch vom Bahnhof zur Sonne - unterbrochen durch Einchock und Gepäckabwurf Jennys und Kilians am Marburger Hof - begon·g uns in Gestalt der Station "Der Wolf und die sieben Geißlein" der Grimm-dich-Pfad, daran gemahnend, dass Marburg Studienstadt der Brüder Grimm war. Ein umso passenderer Ort für eine PerVers, sollen doch auf Jacob Grimm die germanistischen Termini von der "starken" und "schwachen" Deklination (und Konjugation?) zurückgehen. Auch auf dem Marsch war es, dass Günter den Begriff des "militanten Provinizialismus" zur Wahl unserer Versammlungsorte prug, auf Englisch übrigens, denn es handelte sich ja dank meiner Begleitung um die erste PerVers, die teils auf Neutsch, teils auf Chinglisch, mit Untertiteln, ausgetragen wurde.

Die Nachtwächterstube der Sonne stoll sich als jedes rechten Winkels und aller Orthogonalen zur Schwerkraft enthoben heraus, horizontal kann jeder. Der Effekt war durchaus angenehm, nicht so wie die Jugendherberge Solingen-Gräfrath, deren 666°-Winkel, trapezoederförmige Tagungsräume und kaum merklich immer schmaler zulaufende Korridore sich nur als gotteslästerlich bezeichnen lassen.

Stefan, von dem schon die Rede war, ist seines Zeichens Semitist und wewuss zu berichten, dass im Arabischen die schwachen Verben die unregelmäßigen und die starken die regelmäßigen sind - Memo an mich selbst: dies noch einmal genauer angucken. Zu den ersten grammatischen Gesprächsthemen gehörte auch das Rezipientenpassiv im Deutschen mit dem Beispielsatz: Das ist das, was ich die ganze Zeit gesagt, aber nicht geglaubt gekricht habe. Diese kriegen-Konstruktion ist ambig, außer einem Rezipientenpassiv kekünne es sich auch um kriegen i.S.v. schaffen handeln: Ich krich dat nich in meinen Schädel. Oder ein ruhrischer Lehrer kekünne sagen: Ich krich euer Blagen dat nich gelernt.

Fortsetzung folgt - und bitte alle einhaken! Ich find, wir können das so als Fortsetzungsroman mit wechselnden Stimmen machen, statt hier nach geheimer Absprache ein monolithisches Protokoll hinzuknallen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-24, 12:57:55
(...) Auch auf dem Marsch war es, dass Günter den Begriff des "militanten Provinizialismus" zur Wahl unserer Versammlungsorte prug, (...)

Just SO soll es sein - wenn ich an die Theresianische Militärakademie in Wiener Neustadt denke, der Welt älteste Militärakademie, eine wahre
Kader(Kater?-)schmiede! - :
http://www.bmlv.gv.at/karriere/offizier/index.shtml
(Dies schrieb ein Sieche-gepflogabender Zivildiener.)
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-24, 14:16:22
Fortsetzung folgt - und bitte alle einhaken! Ich find, wir können das so als Fortsetzungsroman mit wechselnden Stimmen machen, statt hier nach geheimer Absprache ein monolithisches Protokoll hinzuknallen.

... mangels eigener aufzinche kann ich momentan noch nix ergänzen, nicht mal die ganzen schönen neuen ämter ... und ein vorgriff auf die bahnbrechenden wissenschuftlen erkenntnisse und theorien *, welche diese perVers hervorgebracht hat, steht mir nicht an ...

... ich mache mich jedoch erbötig, amarillens bilder (die ja ohnehin mehrheitlich ich geschossen habe) samt und sonders mit erläuternden texten zu versehen, wenn sie hier mal endlich eingestollen würden ...



* mir ist endlich eigefallen, wie wir das noch ent zu deckende boson vorläufig nennen sesüllen: x-boson ... wer's dann tatsalch als erster nachweist und passend in die große formel einbaut, dessen namen soll es tragen - wäre zumindest mein vorschlag ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-24, 19:35:53
... ich mache mich jedoch erbötig, amarillens bilder (die ja ohnehin mehrheitlich ich geschossen habe)...

Sisso, ich neige beim Fotografieren zur Fäule :-[

Ich war aber so rotzig, dem Scheff eine CD mit den Bildern zu senden und ihn darum zu bitten, eine Auswahl nach seinem Gosto hier einzustellen, da ich sonst schon wieder nachfragen memüsse, wie das geht.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-24, 21:18:43
... ich mache mich jedoch erbötig, amarillens bilder (die ja ohnehin mehrheitlich ich geschossen habe)...

Sisso, ich neige beim Fotografieren zur Fäule :-[

... das traf sich doch gut, denn ich hatte umso mehr spaß am fotografieren ... perfektes teamwork also :D

Ich war aber so rotzig, dem Scheff eine CD mit den Bildern zu senden und ihn darum zu bitten, eine Auswahl nach seinem Gosto hier einzustellen, da ich sonst schon wieder nachfragen memüsse, wie das geht.

... aber das ist doch nun wirlchk einfach über "anhänge" :o ... naja, warten wir eben ab, bis kilian die pics eingestollen hat, texte mache ich dann gerne ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-24, 22:54:45
Warum ist dieser Faden hier eigentlich im nichtöffentlichen Bereich? Sollen vorbeireisende noch-nicht-PerVerse nicht Lust gemacht kriegen, beim nächsten Mal dabei zu sein? Fotos kommen natürlich unter Verschluss.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-25, 00:40:04
Sehschauchso. Stelle hiermit anheim und rage beant, diesen Faden nach "Omnia licent" umzuziehen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-25, 02:03:21
Die Post funktioniert ja hervorragend, amarillos CDs sind schon bei mir eingetroffen. Es sind fantastische Fotos dabei. Müsst euch aber noch etwas gedulden, bis ich die sortoren, gedrunden, skaloren und hochgeladen hab.

Weiter im Protokoll: katakura brachte eine eindberuckende Liste in der Vergangenheit vertielener GSV-Ämter mit. Ich rege an, diese Liste hinkünftig auf einer Wiki-Seite zu führen. Wir soochen sie zu erweitern, vom Brainstorming landete Folgendes in meinen Aufzinchen. Bertl, ich hoffe, du bist uns nicht böse, dass wir überlegen, dich hinkünftig als Bertl der Autokorrektor, Referent für Selbstbespiegelung, Autoreferenzialitätsauftberagenen oder Vollzeitaddendisten tituzulieren. Trotz diesmaligen Erscheinens sahen wir katakura auch weiterhin als qualifizoren an, ein Amt zu übernehmen, das mit seinen häufigen kurzfristigen PerVers-Absagen zu tun hat, etwa Vergeblichkeitsauftberagener. Das schlösse sich gut an das von ihm bereits innegehabte Amt Auftberagener für Durchunvorhergesehenëumständezwischenperverslichgekniffensein an, an dem mir besonders gut das Trema gefiel. Trockene Erwiderung auf mein verzockenes Quieken: "Kein Trema."

Ein weiteres Sprachthema von der "Sonnen"-Runde am ersten Abend: Wie heißt beim Fangenspielen auf Spielplatz und Schulhof die Gegend, in der man nicht gefangen werden darf? Anscheinend ist das regional höchst unterschiedlich, mit bis auf kleinste Gegenden beschränkten eigenen Begriffen. Wo Rebecca herkommt (irgendwo im Schwabenland), sagt man Horre, ich erinnere mich an Häuschen, viele weitere Begriffe sollen existieren.

Nun wurde bereits dazu gekommen, wo die PerVers mit der derzeit heiligen Nummer XVI stattfinden soll. An Nominuren mlong es nicht: Bamberg, Heidelberg, Groningen, Weimar, Münster, Leipzig, Rom, Bozen, Berlin (dies nunmehr als geborener Kandidat gemäß GSV-Satzung, weil es eh nie gewählt wird), Luxemburg, Neugablonz (http://de.wikipedia.org/wiki/Neugablonz), Görlitz, Hameln, Trier, Koblenz, Worms, Erfurt, Schwäbisch Hall.

Fortsetzung folgt.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-25, 02:45:59
Weiter im Protokoll: katakura brachte eine eindberuckende Liste in der Vergangenheit vertielener GSV-Ämter mit. Ich rege an, diese Liste hinkünftig auf einer Wiki-Seite zu führen.

... dein wunsch, mein geliebter sprachführer, ist mir wie stets befehl: ich habe die seite schon einmal gefollen, verborsse an texten oder struktur sind ggf. noch nötig ... frage 1: ist die bisherige sortur nach mitgliedernamen sinnvoll, oder sesüllen wir eher alphabetisch nach ämtern sortieren? ... frage 2: in welcher rubrik findet sich die seite im wiki? ... frage 3: sesülle ich bei "über die gsv" noch einen unterpunkt zu ämtern inkl. link anlegen? ...

Trotz diesmaligen Erscheinens sahen wir katakura auch weiterhin als qualifizoren an, ein Amt zu übernehmen, das mit seinen häufigen kurzfristigen PerVers-Absagen zu tun hat, etwa Vergeblichkeitsauftberagener. Das schlösse sich gut an das von ihm bereits innegehabte Amt Auftberagener für Durchunvorhergesehenëumständezwischenperverslichgekniffensein an ...

... ich verstand mein neues amt vor allem aber auch dahingehend, dass damit mein (zumeist vergeblicher) einsatz als langjähriger auftberagener für NÖA/CP gewürdigt werden soll ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-25, 03:23:30
... dein wunsch, mein geliebter sprachführer, ist mir wie stets befehl: ich habe die seite schon einmal gefollen, verborsse an texten oder struktur sind ggf. noch nötig ...

Super, vielen Dank!

Zitat
frage 1: ist die bisherige sortur nach mitgliedernamen sinnvoll, oder sesüllen wir eher alphabetisch nach ämtern sortieren?

Finde ich gut so.

Zitat
frage 2: in welcher rubrik findet sich die seite im wiki?

Rubriken, hab ich ergonzen.

Zitat
frage 3: sesülle ich bei "über die gsv" noch einen unterpunkt zu ämtern inkl. link anlegen?

Ja, gute Idee!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-26, 01:05:23
Kurzer Zwischenrückschwiff:

Freitags Vormittags des Wegs zwecks Abhuls Bahnhofs Kus erlab der Ganter, dass ein Marburger städtischer Busfahrer (Linie 5) in seinem Cockpit dezent der Musik Bob Marleys lüsche. Woanders wär's verboten, hier geht das offenbar.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-26, 01:07:33
Mittfreitälges Empfangskomitee: Die zuvor anmotoris georenen Amarillo und Karsten seauvie der schon vorab akklimatisoren sich gehabt habende GüGa beteppochen Ku rot. Dessen Koffers Abwurf falg Sonnens. Vor Orte Biernahme. Gemulte Spazur durch Marburgs schön & bißweilen etwas schief fachgeorkwene Altstadt.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-26, 01:17:54
Imbissens in der "KostBar" (mal wieder so 'n "Haarmonie"- oder "Biß-tro"-artiger Marketing-K[r]ampfname; Mampf war aber okeh) schrald Amarillo die Entwulck seiner geradezu katholischen Stuhldisziplin: Früher hölte er einen Stapel Zeitungen seitens seines heimischen Stillen Örtchens vor, jetzt tät's ihm's ein Kindle, von welchem er recht begirsten sey.

Zwischendurch verfiel er in milde Panik bezülg des Verbleibs seines Kraftfahrzeuges, welches er, sich nicht gans sicher seyend ob der Legalität des Parkplatzes, irnxwo abgestollen hatte. Dazu – und zu unzähligen anderen Geliegenen – betatog Karsten jederzeit seinen mitgebrongenen Panic Button, was auf Dauer – speziell beim Diner – etwas norv.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-26, 01:22:58
Beobocht alldort: Vor der "KostBar" verkohr tatsalch ein (wenn auch kurz-kompakter) Linienbus (Nr. 10) durchs schmale, kopfsteingepflurstene Fußgängergäßlein. Die herb-hübsche Busfahrerin, ob unseres Anblicks offenbar verzurben, befuhr die Kante von Kopfstein zu Asphalt darauf offenbar mit mindst 4 statt der vorgeschriebenen 3 km/h, was das untere Heck des Busses mit einem herzhaften "Bronks!" (Geräusch von Stahl auf Stein) quittor. Dies vollzog sich an der Ecke Barfüßerstraße/Am Plan, wo sinnigerweise der Magistrat der Universitätsstadt Marburg seinen Fachbereich "Planen, Bauen, Umwelt" siedeln lässt. Dort tätige planende Beamte lauschen alltäglich dem häufigen "Bronks!" und sinnieren weiter über Plänen bzgl. der Kompatulb von Bussen und kopfsteinernen Gäßchen. Planmäßig eine Stunde später sahen wir dieselbe Busfahrerin wieder – sie grans, wonk & fuhr gaans lanxam, diesmal ohne "Bronks!". Wär' ja auch zu peinlich, bei jeder Runde.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-26, 01:24:59
Später Walchs zur feinen Cafébar "5 Jahreszeiten" inhallts prächtschen lederbesofanen und -besolssenen Spiegelsaals.

Zwischenabschwiff: Misread Words aus dortner Getränkekarte:
Gelsenkirchen
statt
Glenkinchie (ein Single Malt Scotch)
Rück- und Wiedereinschwiff.

Wir beogen jedoch die nicht minder schöne Ausblickterrasse ersten Stockens bevorz, in Erwurtt des Homers und der Rebecca. Diese progen den Übersazz Spiegelreflex = Zurückbiegungsraum.

Karsten bejurmm seine kurze Nacht; in Opladen habe morgens vor siebene noch kein Laden geonffen gehabt gehabt, was ein Oxymoron sey, wie auch der Name seines Hotels: "Village Stadthotel".

Bemorke zur Muskelbildung einheimischer und zugroaster Marbürgerinnen und Marbürger: Starke Schenkel durch Bezwang zahlloser Treppen und Stiege entwölcke man wohl so nach ein, zwei Jahren des Hiesigseins. Fitnessstudios gehen in Marburg ausgesprochen mau, und für Gehbehinderte ist die Stadt definitiv nix.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-26, 01:27:30
Zum Freitagabendem undem späterem Weiterem später mehr...
Titel: Re: PerVers XV Marburg 2012 - eine Hypothenuse
Beitrag von: Berthold am 2012-10-26, 16:08:50
(...) Linienbus (Nr. 10) (...) Die herb-hübsche Busfahrerin, ob unseres Anblicks offenbar verzurben, befuhr die Kante von Kopfstein zu Asphalt darauf offenbar mit mindst 4 statt der vorgeschriebenen 3 km/h, (...)
Planmäßig eine Stunde später sahen wir dieselbe Busfahrerin wieder – sie grans, wonk & fuhr gaans lanxam, diesmal ohne "Bronks!". Wär' ja auch zu peinlich, bei jeder Runde.

Heißt diese Busfahrerin vielleicht Gerhild oder Gertrud - und hat in Wien (Warteplatz befurtzogen Hernalser Hauptstraße nahe dem "Brandstetter"-Wirten) eine taxifahrende Schwester namens Gerda? Genannt die Grünkralle mit den ("die") Pupperln. Dann hätte mich jene u.U. des Busses verwiesen ...

Selbst die Buslinie 10 spricht für meine Hypothenuse, weil nahe meiner Wohnung (Haltestelle Wattgasse) der 10A verkehrt! Herb-hübsch sowieso!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-26, 16:32:00
(...) Dazu – und zu unzähligen anderen Geliegenen – betatog Karsten jederzeit seinen mitgebrongenen Panic Button, was auf Dauer – speziell beim Diner – etwas norv.

's 'n das, ein "Panic Button"? Ein Knöpferl, das zu pfeifen anhebt, wenn sich ein Meßfühler über zu geringen Serotoningehalt im Blut beschwert? Worauf eins dreivier Pillen einzuschmeißen hat? "Kleinzac", "Cinober" oder was anderes?
- - - Ich dedorf mir so einen Schrieb erlauben ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Trapper Toni am 2012-10-26, 16:54:53
- - - Ich darf mir so einen Schrieb erlauben ...

Was erlauben ... Berthold!!!

 :D  :D  :D
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-26, 17:04:25
- - - Ich darf mir so einen Schrieb erlauben ...

Was erlauben ... Berthold!!!

 :D  :D  :D

Hier nahezu alles, weil's mit Liebe geschieht; erst recht meine Antwort # 21. Aber präteritifiziere ich halt den Schlußsatz. Die drei Pünkteln zeigen hier nix anderes als Gedankenschwere ... 
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Fleischers Karsten am 2012-10-26, 20:50:28
Das ist alles gelogen. Den Panic-Button hatte ich freitägens gar nicht mit dabei. Erst samstägig.

@Bertl: Den Panic-Button kann man amazonal bestellen. Ein rundes Ding mit einer roten Wulb, auf der guschrimp steht "Panic". Haut man drauf, sacht das Ding so was wie "Initiating panic sequence: three - two - one - Aaaaaah!"
Den ham alle an dem großen Weichwarenprojekt bei HRS zu Abschluss geschunken gekrochen.

Der Panic-Button ist mir allerdings irgendwann in der Nacht von Samstag auf Sonntag verlustig gegangen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 01:34:49
Tsumami Freitagabenz:

Abenz Mahls in Sonnens Gasthofs holzgetulfener Zimmermanns- (oder Zirbel-?)stube, welche in leichter Schräglage sich befand, wass bei alten Fachwerkgebäuden in derart steilem Geländegeläuf keine Seltene sei. Den selzamen Humor des Kellners verstanden wir zunäxt nicht, bis wir auf den Gschmack kamen – leltzt entpopp er sich als optimaler Cameriere für unsre Gesullsch. Essen als lecker beworten.

Kürbsi (Vertopper in einer Speisekarte) fällt unter überschotzene Lebensmittel.

Applaus: Kilian verkond das 10. Jubiläum der GSV (für November) und plant eine Modernisur der (nicht mehr so neusten) "Neuesten Nachrichten" auf der GSV-Startseite.

Kurz hatten wir's mit Singlish, also Singapur-Englisch, einem verienfachenen, mit chinesischen Elementen angeriechenen kwasi Pidginglish, wass die dortene allmächte Regur nicht mog, weil's das Premium-Image støre. Doch die Singaporians ließen's sich nicht nehmen. Ein kleiner Sieg der Demokratie in einer gesturenen Demokratur!

Für Jenny schienen wir noyn Europäer einander äußerl ähln zu sehen (steile These), aber für uns sehen Chinesen ja auch alle ähln aus. Darauf Diskuss über Physiognomiken, wie: Woran erkennt man einen Innerschwyzer, Norweger, Bayern etc.? Fazit: Der aktülle James-Bond-Darsteller Daniel Craig sieht aus wie einer von Moskau Inkasso.

Stefan verwies auf die – für Linguisten sehr praktischen – Leipzig Glossing Rules (http://www.eva.mpg.de/lingua/resources/glossing-rules.php).

Bezülg kynftger perVerser Austragsorte wurde mal wieder auf den Scharm hässlicher Städte rekurr georen, wozu GüGa Neugablonz beitrug, was ihm den Auftrag eintrug, er möge es verlabenzen und dort eintragen. Magucken.

Kurzer (für GSV-Maßstäbe) Absacker im "Hinkelstein" (GüGa, Karsten, Stefan). Laut & urig, und dort wird tatsalch noch geruchen, undenkbar in Bayern.

Tsum Samstak später meer.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-27, 13:40:56
Kurzer Zwischenrückschwiff:

Freitags Vormittags des Wegs zwecks Abhuls Bahnhofs Kus erlab der Ganter, dass ein Marburger städtischer Busfahrer (Linie 5) in seinem Cockpit dezent der Musik Bob Marleys lüsche. Woanders wär's verboten, hier geht das offenbar.

Im Tübinger Airportsprinter ließen sie oft Schlagersender dröhnen. Das gehœre verboten!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-27, 13:48:40
Für Jenny schienen wir noyn Europäer einander äußerl ähln zu sehen (steile These), aber für uns sehen Chinesen ja auch alle ähln aus. Darauf Diskuss über Physiognomiken, wie: Woran erkennt man einen Innerschwyzer, Norweger, Bayern etc.? Fazit: Der aktülle James-Bond-Darsteller Daniel Craig sieht aus wie einer von Moskau Inkasso.

In haulser Nachbesprechung ist noch herausgekommen, dass sich die PerVersen vom Kleidungsstil her grob in "scholars" und "gangsters" einteilen lassen (ich überlasse jedem die Selbsteinordnung) und katakura sehr häufig die Jenny bereits bekannten deutschen Phrasen wunderbar und ich weiß gebrooch.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-27, 14:18:58
Was wurde noch gesagen in der Sonne?

Dass, um der immer noch verbrittenen Diskriminierung Neutschsprachiger im olfftenen Leben entgegenzutreten, Neutsch als Amtssprache dorchgesotzen gehœre.

Ich darf mir wohl erlauben, auch diese hier ge·urßene Frechheit wiederzugeben: Wir sprachen über ein kugelförmiges Sprachmonster, den Bertilisken, der Unvorsichtige zu Stein erstarren lässt, indem er sie zutixt. Das Prädikat der Kugelförmigkeit kommt dem Vorsokratiker Xenophanes zufolge übrigens auch Gott zu (ich habe mich beim Lesen von Wolfgang Röds Geschichte der Philosophie, Band I, schon gefragt (https://twitter.com/texttheater/statuses/160833805635162113), ob es auch Xenophanes selbst zukam).

Wiederkehrender Tagesordnungspunkt in dieser Runde war das Betretene Schweigen, fürderhin liebevoll als TOP 6 bekannt. Die Nummer sollte nicht darüber hinwegtäuschen, dass er jederzeit und wiederholt auftreten kann. TOP 6a und 6b sind genießerisches Schweigen respektive sekundenlange Pause.

Karsten, Mitglied der PARTEI (http://www.die-partei.de/?s=ausweis), berocht von deren Mitgliedsausweis, auf dem steht, dass man damit überall durch darf (oder wie war das noch?). So etwas braucht unsere Gesellschaft auch, fanden wir. Dachten wir zunächst noch an einen Ich-darf-das-Ausweis (http://www.parkverbot.org/gimmick/darfdas.htm), unwiderruflich und mit Zauberspiegel und Ben Gurion (http://www.dieterwunderlich.de/Kishon_Lot.htm), der Ausweis to end them all, die Mutter aller Ausweise, die ihre/n Träger/in zu schlicht allem berechtigt, kamen wir dann auf die Idee, ein Ausweis mit der Aufschrift berechtigt zu gar nichts sei doch eigentlich viel cooler. Man kekünne ihn auch Einweis nennen, zwangsverordnet, personengebunden und nicht übertragbar.

Wir kamen zurück zum Ruhrdeutschen und seiner Verlaufsform mit gerne vervielfachtem am: Ich war schon ganz verzweifelt am Pfarrer am rum am Suchen, Der Arzt war den Patienten am an am Nesen.

Eine Idee für einen neuen Faden ward geboren: Wort des Augenblicks. Wo man schöne und bemerkenswerte Wörter wie z.B. saumselig der Diskussion oder dem Schweigen der anderen Forennutzer/innen preisgibt, je nach dem.

Wir hatten es weiterhin von Phonästhemen (http://verben.texttheater.net/forum/index.php?topic=262.0) (ein Savant hatte sie als Eselsbrücken benutzt, um in kürzester Zeit eine ganze Sprache zu lernen) und von neuen gastronomischen Präpositionalismen ala Ente an Safranreis, z.B. Klöße nach Ente oder Brot nach Käse, die beschreiben, was Günter an der Sonne zu Recht bemolng: "Es fehlt a weng die Synchronizität des Serviervorgangs."

In welchem Zusammenhang ich das neue Musikinstrument Pentangel notor, weiß ich nicht mehr. Soll die GSV etwa ihre eigene Marching Band bilden?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-27, 14:34:17
Hinsilcht des Buchprojektes der GSV, des Groben Dubens, konstatoren wir das Übliche: Es gibt große Ideen, aber keinen konkreten Handlungsbedarf. Wir stollen aber fest, dass wir mit so mancher erfolgreicher Publikation von Eichborn etc. allemal mithalten kekünnen, an Qualität und Verkäuflichkeit sesülle es nicht scheitern.

Damit sind meine Aufzeichnungen aus der Sonne erschopfen, die Fortsetzung folgt mit meinen Gesprächsnotizen aus der Dammmühle. Mag jemand vorher erzählen, was bis dahin geschah?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Amerikareisender am 2012-10-27, 15:07:17
kamen wir dann auf die Idee, ein Ausweis mit der Aufschrift berechtigt zu gar nichts sei doch eigentlich viel cooler.

Sowas kann man sich beim amerikanischen Konsulat besorgen. Habe das schon einmal gemacht. Auf den Visum steht u.a. "Dieses Visum berechtigt nicht zur Einreise in die Vereinigten Staaten von Amerika." Kein Witz.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-27, 17:35:07
Schabe den Samstag in seiner Gänze momentan nicht parat, erirnne mich aber, daß wir bei der Lektüre einer Speisen-/Getränkekarte der Idee zur Geburt verhalfen, der Deutschen Gastronomie künftig unsere Dienste (gegen horrende Honorare, versteht sich) anzubiedern, ihre Angebotsverzeichnisse sowohl rechtschriebhalber als auch kommatös auf einen akzeptablen Stand zu bringen. Kurz: gnadenlose Ausnutze der offenbar selbst in der gehobenen Gastronomie um sich greifenden Lese-/Rechtschreibschwäche.
Die angehuffenen Erträge kekünne man ja dann anlalß künftiger PerVersen und Wallfahrten hemmungslos verknattern.

Wobei mir auffällt: wir haben überhaupt keinen Marketing-Strategen - Freiwillige? Schwürde mich ja melden, aber schaut Euch mal die Latte meiner Ämter an - ich weiß gar nicht mehr, wo mir der Kopf steht, wo ist der Panik-Knopf? Hilfe, Herr Auftberagener für latente und akute Hysterie - meine Nerven...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 17:45:31
... dann mach ich mal den anfang, was den samstag angeht ...

... allgemeines aufstehen und frühstücken der perVersen in den diversen marburger hotels / unterkünften, u.a. der bestrenommorenen "sonne" am marktplatz, in der ku, amarillo und meinereiner logoren ... danach zusammenströmen der perVersen bis 10 uhr am ausgangspunkt des stadtrundgangs, der elisabethkirche ... dort geraume zeit herumstehen und warten u.a. auf den als letzten erscheinenden ganter, der c.t. mit einem ominösen roten beutel auftoch, dessen inhalt vorerst jedoch vor aller augen verborgen blieb ... danach gemeinschalfte besichtag des ältesten rein gotischen gotteshauses im deutschsprachigen raum (u.a. vorbild für den kölner dom) ... die moderne orgel wurde allgemein für zu bunt und daher unpassend empfunden, weselnt mehr gefiel der prächtige gotische sakophag inkl. baldachin für die heilige elisabeth, in dem sie seit der reformation (und der damit verbundenen entfarn ihrer gebeine, gearme etc. durch den protestantischen landgrafen philipp) allerdings ebenso wenig ruht wie in dem prächtigen güldenen schrein (erorrn an jenen der hl. drei könige in köln) in der angrenzenden sakristei ... sehr beeindruckend ebenfalls: die hochgotische grablege der hessischen landgrafen neben dem chor ... das grab des feldmarschalls von hindenburg, das sich seit dem zweiten weltkrieg unpassenderweise auch in dem ehrwürdigen gotteshaus befindet (die amis wussten einfach nicht wohin mit paule, als sie die deutschen bei marburg mit ihm überroschen), ward hingegen nicht gefunden - und eigelnt auch nicht gesoochen :) ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 18:02:25
... nach eingehender betrucht der elisabethkirche von innen und außen (wo u.a. jesus am kreuz "die marilyn macht", wie ein perVerser konstator) wolnden die perVersen etliche stufen der kirche gegenüber hinauf zur "michelchen" genannen alten pilgerkirche "st. michael" ... die kapelle war zwar verschlossen, doch boten durmherum etliche halb eingesunkene grabsteine vornehlm aus der barockzeit einen malerischen anblick ... weiter oberhalb des michelchen wand sich ein "am weinberg" (den es aber gar nicht gab!) genannener schmaler weg zwischen großartig am südhang gelegenen villen (mit top-ausblick zum gegenüber auf einem bergsporn emporragenden schloss) entlang ... den dort entlangwandelnden perVersen fielen vor allem die von den eingeborenen angelegenen metallenen schrägaufzüge ins auge, mit denen wahrscheiln die samstalgen einkäufe in schneller fahrt (und nicht in langsamer tragung über steile stufen) zu den weiter unten liegenden häusern befördert werden ... tolle erfindung, aber leider gerade nicht in betrieb ... nach ausgiebigem genuss des blickes auf die marburger altstadt und das darüber thronende schloss ging es wieder hinab zur elisabethkirche und hinein in das gewirr der fachwerkumstandenen gassen ... indes: man kam nicht weit, da schon beim erstbesten (italienischen! was sonst!) café eine rast eingelegen werden musste ... immerhin war es über elisabethkirche, michelchen und weinberg fast schon 12 uhr geworden ... der einnahme von diversen heißen und kalten getränken fulg der steile aufstieg über kopfsteingepflurstene straßen, wobei am steinweg andächtig die riesigen köpfe der sieben geißlein und der noch riesigere kopf des eher an einen bären erinnernden wolfes aus dem grimmschen märchen gegroßen wurden ... die weit über den köpfen der vorübergehenden angebrachte installatur ist teil des überaus witzig ::) benannen grimm-dich-pfades durch marburg, auf dem mittels großer bunter figuren an verschiedenen stellen der stadt an die kinder- und hausmärchen der beiden sprachmächtigen brüder erorrnen wird ... kurz darauf begongen die perVersen bleistiuftsweise dem oberhalb eines brunnens hockenden froschkönig, dem jedoch nicht allzu viel aufmurks geschonken wurde, da das nächste ziel lockte: die ehemalige kilianskapelle!!!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 18:16:14
... am schuhmarkt versolmmen sich die perVersen vor den stufen der einstigen kapelle, des mit über 800 jahren ältesten gebäudes der marburger altstadt, um dem geliebten sprachführer kniend zu huldigen und seinen segen zu erflehen ... gnädig wurde dieser vom huldvoll lächelnden gesalbten nach geraumer zeit denn auch ertielen, wobei großzügigerweise auch die stadt und der weltkreis etwas abbekamen - ohne davon jedoch notiz zu nehmen ... sich ganz auf den pompabtielvollmbeachtogenen güga verlassend, besachtogen die durch den segen machtvoll gestorkenen perVersen im folgenden den einbedruckenden, steil zum rathaus hin abfallenden marktplatz marburgs, der nicht nur durch das vielfach fachwerk betört, sondern auch durch das gewusel an einheimischen und touristen ... nalmes gewusel war es dann auch, das den bis dahin nahezu geschlossenen marschblock der perVersen in der vom markplatz abzweigenden barfüßerstraße (die zwecks aufstieg zum schloss betreten worden war) aufbrach ... eine dreiergruppe, bestehend aus amarillo, karsten und mir, konnte sich unbeabsachtogen vom pulk der anderen perVersen absetzen und verlor im steten vorwärtsgehen den blickkontakt zur hauptgruppe um den trotz marburg-innenstadtkarte (die er mal hierhin, mal dahin drah und wand, um sich zu orientieren) zunehmend verwurrener wirkenden pompabtielvollmbeachtogenen güga ... diesem ward, soweit ich mich erinnere, ob seiner unkenntnis der marburger topographie auch spontan das treffende amt des auftberagenen für verurr und verwurr (oder so ahln? hat jemand die genaue bezinch verzinchen?) verliehen ... dennoch fand die ausreißergruppe wieder zurück zum hauptfeld und strob mit diesem den schneidersberg treppauf gen schloss ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 18:26:05
... an der pfarrkirche st. marien ward erneut halt gemuchen, da einige perVerse bereits etwas schwolchen ... die rast bot indes gelegenheit zu mehrerlei:

- zur erhul vom bisherigen aufstieg
- zur äußerlichen betrucht des gotteshauses (ins innere begab nur ich mich, alldieweil es drin so schön orlg - und ich ward vom organisten nicht enttoschen, der wohl gerade für den sonntalgen gottesdienst prob)
- zum schießen des ersten erinnerungsfotos der perVersen
- zum beiläufigen mithören der ausfuhren einer marburger stadtführerin, die allen ernstes gegenüber einer älteren touristengruppe behupt, der ebenso krumme wie schiefe turm st. mariens sei absilcht so gebauen worden (naja, was will man in der stadt der grimms anderes erwarten als märchen?)
- zum sanften erschrecken und ungläubigen staunen ob des anblicks eines mannes, der ob seiner statur als bertls zwillingsbruder identifizioren ward

... nach diesem spontanen gedenken an den wiener korrespondenten der GSV ging es weiter hinauf gen schloss - natchlur über treppen! ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 19:40:34
... knapp unterhalb der schlossbergterrasse hatten marburgs stadtväter sinnigerweise auch ein zitat der gebrüder grimm auf den unendlich erscheinenden stufen der ludwig-bickell-treppe anbringen lassen, in welchselbigem die beiden gar grimmig über ebenjene treppen klugen und behupten: "es sind mehr treppen auf den straßen als in den häusern" ... zumindest ku und amarillo schienen bei ihrer zwischenrast auf einer nahe jener treppe gelegenen (naja, memüsse es nicht heißen: gestandenen?) bank sehr geniegen, dieser einschotz zuzustimmen ... allen widrigkeiten und steilheiten zum trotz ward dann doch glulck die schlossbergterrasse errichen, oberhalb sich derer gar mächtig das marburger schloss erhebt ... überhaupt nicht irritoren ziegen sich die perVersen vom einem riesigen roten stöckelschuh am aufweg zum schloss, der geschwind als teil des grimm-dich-pfades diagnostiziert und dem seligen aschenputtel zugeschrieben ward ... dass die dame rote pumps (von prada?) trug, war zumindest eine neue information, welche die grimms in ihren märchen bislang verschwiegen hatten ... aber gottseidank wussten die marburger besser bescheid! ...

... an der aussichtsterrasse wurde der nächste halt eingelegen und zum schießen diverser erinnerungsfotos mit diversenen hintergründen (schloss, marienkirche, altstadt) genotzen ... überaus entzocken zieg sich pompabtielvollmbeachtogener güga ob der tatsache, dass er die perVersen nach gefühlten fünf stunden und gefühlten 20.000 höhenmetern (so schotz zumindest amarillo) nicht nur heil zum schloss hinaufgebracht hatte, sondern dass auf ebenjener aussichtsterrase die mauern von zirbelnüssen (teilnehmer der augsburger perVers erinnern sich!) gekronen warden ... einziger wehmutstropfen (sic!) führ ihn: die marburger zirbelnüsse waren allesamt ihrer spitzen entladogen und konnten solcherart abgestumpfen nicht mit ihren weselnt filigraner auslaufenden augsburger schwestern mithalten ... unter derlei erwägungen ward schließl der (im wahrsten wortsinne) höhepunkt der marburger perVers errichen: das portal des ehrwürdigen landgrafenschlosses ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 19:48:08
... eine besichtigung des schlossinneren ersporen sich die perVersen, ledilchg das moosüberwurchene pflaster des schmalen innenhofes und ein dort befilndes seltsam erschröckliches großrelief landgraf hermanns I. und seiner gattin, der heiligen elisabeth, bewurnden sie ... während güga es noch immer ablahn, den inhalt seines ominösen roten beutels preiszugeben, posor ku ein wenig als gansterrapper alter schule (ledilchg die protzige, großgliedrige goldkette fahl zur perfektionur des auftrittes und zum gewinn des RUN-DMC-ähnlichkeitswettbewurbs) ... ansonsten bot sich von dort oben eine herrliche aussicht auf das von buntem herbstlaub malerisch umronkene marburg mit seinen schiefergedockenen fachwerkhäusern ...

... nach einem weiteren und längeren zwischenstopp mit pils und laugenbrezeln auf der schlossterrasse ging es zunächst steil bergab die landgraf-philipp-straße, von der schlielß die schlosstreppe abzwog ... und dort elnd fand güga einen kleinen platz mit bank, der ihm würdig und geiengen erschien, den inhalt seines beutels preiszugeben ... unter den erwartungsvollen, wenn auch durch die vorangegangenen anstrengungen schon etwas matt gewordenen augen der perVersen hob er eine flasche sprufki bumkrak grimmzk sowie neun stamperl aus jenem beutel ... unter großem kriegsgeheul der anwesenden und den verwirrten blicken vorbeigehender touristen ward die heilige flasche mit dem heurigen sprufki von güga stolz herumgeziegen, dann geonffen und ausgeschonken ... die nachfolgende verkust des 2012er-sprufki verlief ruhig, wohl auch deshalb, weil die diesjährige abfüllung im gegensatz zu ihren vorgängerinnen erstauln milde ausfiel ... einige wöhnten daher arg, dass die molwanischen schnapsbrenner schon nicht mehr nach dem ursprunlgen rezept brönnen, sondern molgerweise nach verweichlichten eu-richtlinien, welche den bisher gewohnten einsatz von diesel, methyalkohol und schmierseife verbieten ... güga wird sich darum kümmern müssen, dass die gewohnte beißende qualität des sprufki nicht nachlässt und auf der nächsten perVers nach dem sprufki-genuss wieder mehr gehustet und gekrochzen wird! ...

... nach der verkust eines zweiten glases sprufki durch die perVersen versooch güga, diese zur nachfolgenden bestieg des fernen kaiser-wilhelm-turmes zu überreden, traf jedoch auf nicht allzu überraschenden widerstand ... fußlahm und pflastermüde zogen es alle anderen perVersen vor, in richtung ihrer diversen unterkünft zu schleichen, um dort den restlichen nachmittag über zu ruhen, "rettungsbiere" konsum zu ieren (karsten, amarillo, ku, güga) oder durch diverse buchhandlungen zu streunen (ich) ... die rettungsbier-trinker ließen es sich angelegen sein, vor der bereits vielfach erwohnenen "sonne" in derselbigen zu sitzen und das bunte treiben auf dem marktplatz zu beobachten ... so verging die zeit überaus angenehm und vor allem ohne treppensteigen ...

... was die anderen perVersen derweil trieben, und wo, entzieht sich meiner kenntnis, daher mag ab hier ein anderer übernehmen und vor allem den weiteren fortgang des samstages beschreiben ... darüber hinaus sind ergonze zu meinen vorangegangenen beschreibungen sehr erwonschen, zumal ich sicher etliches ausgelassen habe, was meinem hirn entfallen ist ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 20:04:27
Tja, hier fällt der erste Schnee, nicht mal die Katze will raus – Zeit, des Goldenen Oktobers @ Marburg reminis zu zieren...

Die PerVersen memögen bitte eftle Doubletten mit katakurens Schrieben verzeihen...

Anlalß samstaxvormittäxlicher Traff vor der Elisabethkirche lief Kilian in Bekonnene, wass sich später Schlossens als nültz herausstall: Die oren uns nälm in foller Kopfzahl fotograps. Danke dafür unbekonnenerweis'.

In Elisabethens Kirche ist diese nicht bestatten, ihre Gebeine, darunter mindst vier Unterschenkelknöchla, vielmehr europaweit in diversen Reliquiengelegen verstrunden*. Dafür ruht hier Generalfeldmarschall Paul Ludwig Hans Anton von Beneckendorff und von Hindenburg, weil die Wehrmacht 1945 nichts Wichtigeres zu tun hatte, als die reichspräsidentiellen Überreste vor den vorrückenden Soffjetrotarmisten aus Tannenberg zu bergen und die US-Armee später nicht recht wewuss wohin damit.

*) Wiki pädelt dazu:
Die im Schrein aufbewahrten Gebeine der Elisabeth von Thüringen blieben nicht lange vollständig, da Elisabethreliquien sehr begehrt waren: Die erste sicher belegte Elisabethreliquie außerhalb von Marburg ist eine Rippe, die sich um 1250 im Besitz der Sophie von Brabant befand. Kloster Altenberg besaß eine Armreliquie, die möglicherweise bereits 1236 in das Kloster gelangte, in der später die Elisabethtochter Gertrud Äbtissin wurde. Während der Säkularisation – zu Beginn des 19. Jahrhunderts – gelangte das Armreliquiar zunächst in den Besitz des Grafen Boos von Waldeck und gehört heute der Fürstenfamilie Sayn-Wittgenstein-Sayn. Reliquien gelangten außerdem in Städte wie Halberstadt und Udine. Ein Bußgewand Elisabeths befindet sich heute in der kath. Pfarrkirche St. Martin in Oberwalluf im Rheingau.
In Marburg dagegen befinden sich heute keine Elisabethreliquien mehr. Im Jahre 1539 ließ der zum Protestantismus übergetretene Philipp I. von Hessen Elisabeths Gebeine aus dem Schrein sowie den Schädel aus dem Kopfreliquiar entfernen, um den Reliquienkult zu beenden. Der Verbleib der Gebeine ist unbekannt. Es ist möglich, dass der Schädel und zwei Schienbeine letztlich in das Kloster der Elisabethinen in Wien gelangten, wo sie bis heute als Elisabethreliquien verehrt werden. Ihre Echtheit ist nicht ausgeschlossen, allerdings auch nicht belegt.

Müstisch, wie das alles wieder zammhängt: Eisenach, Wien... Die GSV auf gschichtstrachtgen Pfaden...

Hochlicht in der Elisabethkirche war ein ehemals grünes Handtuch, das arg verschmotzen dekorativ von der Kanzelbrüstung hing. Wösche sich damit der Priester nach der Messe das predigaden habende Gemäul? Warum wäscht das greislige Getüch denn keiner mal?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 20:09:00
Beim treppenreichen Anstieg, am lauschigen alten Michelchen-Kapellchen vorbei, das recht repräsentative Vereinsheim der schlagenden Studentenverbindung Hasso-Borussia (http://www.hassoborussia.de/veranstaltungen) passoren. Auf ehemaligen Weinbergen Blick von oben auf die Elisabethkirche genossen. Auf halber Höh schak ein nettes Hundl sich an, uns zu- und seinem eher strengen Herrchen fortzulaufen. Das Tier überlag lang, bis es sich entschloss, doch nicht mit uns zu gehen. Später trafen wir's noch zweimal, dann aber angeleinen. Herrchen hatte wohl was mitbekommen und vorgebauen.

So entdak GüGa einen Indikator für die Liebenswurdike von Städten, nälm den Anteil netter, knuddeliger und freundlicher Hunde an der Gesamthundepopulation. Da ist Marburg gans weit vorn.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 20:12:57
Drauf Marschur zur Marienkirche (Schieferturm = Schiefer Turm) mit grandioser Aussicht auf zu Füßen liegende Stadt (Zitat: "Aussicht wird überbewertet."). Bertl-Doppelgänger in Besucherhaufen gesichtet. Touriführerin beloschen, die den Gästen allen Ernstes erzohl, Mariens schiefer Turm sei absbeochtogen gewesen. Zitat zeitgenössischer Architekt: "Ich schiefe Euch da einen schönen Turm hin."

Betreten des Textes der Grimms (http://blog.onkel-mo.de/2009/10/die-stadt-der-tausend-treppen/) durch Touris auf Treppe zum Schloss erschwur Lesburk.

Schloss: Museum hessischer Volkskunst (erster verbürgter Bembel?) eh geschlossen, nicht nur daher geschmissen. Ein Anlass, unsere Ansprüche an Museales weiter hochzuschrauben, bevor wir uns mal zu einem Besuch herabließen (auch das "Haus der Romantik" ward geflisselnt ignor georen).

Vorm Schloss: grandiose Aussicht (Zitat: "Aussicht wird überbewertet."), ausgiebige Photograpsur. Im zweiten Anlauf, weil Gastronomieterrasse "Bückingsgarten" recht überbevorlken, zu neunt Sechsertisch ergortten, Rettungsflussiken (Biernahme). Die Getränkekarte dort bot Brände: "Gansloser Haselnuss" 4 cl 11 €, "Gansloser Erdbeerlikör" 4 cl 8 €, "Gansloser Waldhimbeere" 4 cl 11 €. Das müssen ja exclusive Şprufkis sein...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 20:16:38
Unterwegs (= -trepps) ward Ku (Zitat: "Das klappt nie!") zum Defätismuswart und Unk-Auftberagenen ernonnen, GüGa zum Auftberagenen für Orienturlosik, Verurr und Kartenleseschwäche, wass zu beweisen war auf der Suche nach der legendären Kilianskapelle. Die ist aber auch seauvasse von unauffällig, dass wir sie schon am Freitag übersahen, liegt sie doch direttemang übergegen dem bereits aufgesoochenen Gastronomium "5 Jahreszeiten".

Vorkapellarisch gebührende, wenn auch teils widerwillige, gar absente Huldag (knienderweis') des Geliebten und nunmehr Gesalbten Sprachführers (wewüllen sich gar einige PerVerse vor versulmmenen Tourischaren nicht zum Affen machen? Gar noch photograpsorisch verewogen?).

Daher Schlusswort dazu: Enthuldigen Sie bitte.

Nebenbei trägt die Kilkianskapelle den Spitznamen St. Panik, denn unser Hysterieauftberagener Karsten war jederzeit bereit, die Nerven zu verlieren und betotag alle naslang seinen mitgebrachten Panik-Knopf.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 20:25:38
GüGa hätte die Gruppe gern noch zum Ober-Ober-Oberaussichtspunkt Spiegelslustturm alias Kaiser-Wilhelm-Turm geschloppen, der throne nun wirlk über dem Janzen. Oder zumindst in den Alten Botanischen Garten, zwengs Garten-Verlustik. Doch die Mehrheit or für Kneipenhockerei pläd. Also Terrasse vor der "Sonne". Dort ward u.a. ein Generalwasser bestollen.

Bedienung bringt Tablett mit Getränken. Ku: "Ich bin das Pils." Bedienung: "Angenehm, Katrin."

Terrassens diversen (nee, eigelnt den immergleichen) Roma-Bands geluschen & Einrad-Feuerschlucker-Jonglage-Gaukler gegucken.

GüGa bestand auf sein(em?) Recht auf Verurr. Kasū: Ich bestehe auf etwas (etwam oder etwan geht nicht).

Gegenteil von outen: innen (Spuren der Erkenntnis verwischen; nachträglich [wenn alle Bescheid wissen] verheimlichen {vgl. Christian Wulff}). Beispiel: Lesbische Mitarbeiterin der katholischen Kirche muss sich permanent innen.

Beispiele für Positiv, Komparativ, Superlativ, Elativ: subtil, til, supertil, supratil (z. B. Waschmittel: Nimm Subtil für kleine Flecken, für sehr große Supratil)

Leserlichbarkeit > Leserlburk (-burg?) = Wienerneutsch

Karsten schweift ab und käfft sich Bücher nebenan (statt perVersen Bücherstapelns, das war wohl mal), u.a. Timur Vermes: Er ist wieder da (ja, der Führer mit dem beschuurenen Bärtchen). Das Buch kostet in D 19,33 € (sic). Es wurde gelorsten, in AUT sesölle es 19,38 € kosten.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 20:29:35
Zwischen 14 und 18 Uhr hält die "Sonne" Siesta. Köche & Kellner lungern rauchend herum, Hotelgäste kommen per Privatschlüssel via Seiteneingang rein. Gastronomisch teilt man sich die Gasse mit dem Sweden "Edlunds" gegenüber, dessen Speisekarte man auch kopfstehend als "Spunipe" lesen kann, das legendäre Lokal des Exilsizilianers Ettore Spunipe, berohmen für seine handgewutzelte Pasta. In dieser Situation ist man als nächst Sonnens geschlossener Haupteingangstür kneipens mehrstündig sässiger PerVerser geradezu genötegen, den Heerscharen orzunkundiger Touristen diese Situation zu erklären. Es gälte, ein Pappschild mit der Aufschrift "Auskunftei. Dreifuffzich" zu fertigen & deult sichtbar auf dem Tisch platz zu ieren.

So warden wir zu Spontanreiseführern für unbedorfene Touristen: Am Steinweg sprachen Passantinnen katakura auf die in alter Mauer verowegenen bronzenen sieben Geißlein an: "Die sehen ja alle gleich aus!". katakura: "Freilich, werte Damen, das sind ja Geschwister." Damen: "Aach was!" katakura: "Ja sehen Sie, da ist ja auch noch der Wolf. In Marburg können Sie überall solche Denkmäler zu Grimmschen Märchen finden." Damen: "Aach. Jaa. Danke!"

Es entstand die Idee, fiktive Stadtführungen zu geben, also beliebigen Touristen in beliebigen Sprachen beliebig abstrus-erfundene Informationen abzuverreichen, etwa: "Im Jahr 1569 eheloch Fürst Sigisbold der Saumselige die Prinzessin Hadalind vom Zapfenstreich aber schon dermaßen. Die Trümmer jener Hochzeitsnacht können Sie hier noch sehen." Telxt beliebig ausbaufähig; nur an der Ortsorientur memüsse speziell GüGa noch was nacharbeiten.

Und dammit nähern wir uns erzählflüssisch schon der Dammühle...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-27, 20:39:07
Betreten des Textes der Grimms (http://blog.onkel-mo.de/2009/10/die-stadt-der-tausend-treppen/) durch Touris auf Treppe zum Schloss erschwur Lesburk.

... das ist nur teilweise richtig ... da ku pausierenderweise abwas, übernahm ich zwecks eines treppenfotos ohne touris spontan das amt der scheuche und vertrieb mit einem scharfen "machen sie sofort platz! ich bin von der GSV!" alle auf der treppe lungernden ... der beweis ist bei amarillens fotos zu besehen: eine treppe ohne menschen, dafür aber mit deult lesbaren grimmschen worten ...

... ich fühle mich überaus gekronken, dass du auf fremde fötö verlunkst, und nehme anstoß! ... bloß mist, dass das amt des bundeauftberagenen für anstoß noch nicht vergeben ist! ... any volunteers?

So warden wir zu Spontanreiseführern für unbedorfene Touristen: Am Steinweg sprachen Passantinnen katakura auf die in alter Mauer verowegenen bronzenen sieben Geißlein an: "Die sehen ja alle gleich aus!". katakura: "Freilich, werte Damen, das sind ja Geschwister." Damen: "Aach was!" katakura: "Ja sehen Sie, da ist ja auch noch der Wolf. In Marburg können Sie überall solche Denkmäler zu Grimmschen Märchen finden." Damen: "Aach. Jaa. Danke!"

... auch hier muss ich korrigieren bzw. ergänzen: die beiden damen und ein herr betrochten etwas blöde die mauer mit den köpfen, ohne sie als die sieben geißlein zu erkennen (so weit ist es mit den alten in diesem lande schon gekommen!) ... als der mann ratlos bemork, dass die ja alle irnxwie gleich aussähen, replizor ich im vorbeigehen schmunzelnd, dass dies kein wunder sei, da die sieben schlielß alle geschwister seien ... und da bei dem ledilchg "aha" machenden und weiterhin etwas blöde dreinschauenden mann der groschen immer noch nicht fiel, ergonz ich, dass dies nalm die sieben geißlein seien... erst da ging ihm und den beiden damen ein kronleuchter auf und sie wussten, wenn sie da vor sich hatten ... im hochgefühl meiner geistigen überlegenheit ließ ich mich noch zu der zusaltzen information herab, dass die installatur teil des sich durch die stadt windenen grimm-dich-pfades sei und empfahl abschließend hoheitsvoll, dass die damen auf dem weiteren wege die augen offenhalten sollten, um froschkönig, fliegen und anderes grimmsches getier zu entdecken ...

Bedienung bringt Tablett mit Getränken. Ku: "Ich bin das Pils." Bedienung: "Angenehm, Katrin."

... um der wahrheit die ehre zu geben: die replik legte ich der bedienung in den mund, als sie sie schon vom tisch entfornen und ku sein bier hatte ... SO witzige bedienungen hat marburg nalm nicht aufzuweisen ...

Leserlichbarkeit > Leserlburk (-burg?) = Wienerneutsch

... hiermit berage ich beim geliebten sprachführer ant, dass das durch bertl geprogene wienerneutsch offiziell als varietät des neutschen anerkannen und fortan in den annalen verewogen wird ... in teilen ist es ja noch neutscher als das deuhochneutsch, wie jeder weiß, der sich schon einmal durch bertls beiträge gekompfen hat ... indes gebührt bertl diesbezulg dank und ehre, denn er vertritt mit dem wienerneutsch am konsequentesten das konzept der mmU ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 21:33:21
... sei hiermit schon einmal festgestollen, dass marburg wohl die perVers mit dem besten wetter, den meisten stufen und den weitestgeriesenen gästen war ...

Darfsch dem Auftberagenen für Detailkorrigur, Berachtog & Ergonz diesen einschenken:
Weitest geriesenste PerVerse waren wohl Agricola (Route Tokio-Mainz), Kilian (Groningen-Wien) oder Bertl (Wien-Eisenach). Ohne Atlasgucken meinsch, Groningen-Marburg töppe dies nit. Das mit dem Wetter und den Stufen sei aber unstrittig.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 21:34:43
Zwischendurch fols und fabulor GüGa noch was von seinen intimen Vatikan-Kontakten via kirchenmusiz ierender Papstbruder (http://www.sueddeutsche.de/bayern/misshandlungen-bei-den-domspatzen-ratzingers-beichte-1.9361), wass selpst dem tief protestantischen Städtchen Marburg anlalß unsrer PerVers ein – wie soll ich sagen – pälpstes Wetter beschor.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-27, 21:57:55
... ich fühle mich überaus gekronken, dass du auf fremde fötö verlunkst, und nehme anstoß!

Tscha, Verlunk auf hiesige Fötö fœhre unsre werthen Gäste ins Nichts - daher in diesem Phall lieber fremde. Und die Seite "Synapsensalat" gefiel mir halt.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-28, 11:07:49
Der Dammühle ist insgesamt kein hervorragender Service zu attestieren. Zum krönenden Aufschluss fulg auf Jennys Bestellung eines schwarzen Tees statt eines solchen die Wiedervorlage eines dem Geschmack nach zu urteilen bereits benotzenen Teebeutels. Recycling in allen Ehren, aber. Nach Reklamation dauerte es noch lange, bis es behoben war.

Weitere Ideen zur betrügerischen Stadtführung entstanden: "Wo heute die Mauer steht, an denen der Wolf und die sieben Geißlein hängen, war früher das Waldstück, wo es passiert ist! Ursprünglich hingen dort die Originalköpfe, bis 1877 wurden sie noch jährlich erneuert. Dann gab es keine Wölfe mehr." Und so weiter, kurz: Fikten, Fikten, Fikten.

Grundsteine zu einer neuen naturwissenschaftlichen Betrachtungsweise der Sprache wurden gelegt. Wir formuloren den Interpunktionserhaltungssatz, dem zufolge z.B. vergessene Kommata stets an anderer Stelle als falsche Apostrophen wieder auftauchen. So erornn sich ein/e PerVerse/r (war's Rebecca?) an langes Brüten über einem schier unverständlichen Satz von Hegel, dem dann - das finde ich das eigentlich Erstaunliche, aber das tut nun nichts zur Sache - Sinn abgetrotzen werden kekunn, indem ein offenbar fehlendes Komma ergonzen ward. Dieses von Hegel vergessene Komma muss demnach z.B. in Heike’s Frisiersalon wieder aufgetochen sein. Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Fortsetzung folgt.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Wortklauber am 2012-10-28, 11:31:31
Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Das ist ein nobelpreisverdächtiges Postulat. Die Existenz des Sprachbosons muss im Standardmodell der Sprachpartikel gefordert werden, um die Malitation der Sprache zu erklären, denn ohne es würde allen Sprachpartikeln die Bosheit 0 zukommen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-28, 11:52:28
Der Dammühle ist insgesamt kein hervorragender Service zu attestieren. Zum krönenden Aufschluss fulg auf Jennys Bestellung eines schwarzen Tees statt eines solchen die Wiedervorlage eines dem Geschmack nach zu urteilen bereits benotzenen Teebeutels. Recycling in allen Ehren, aber. Nach Reklamation dauerte es noch lange, bis es behoben war.

... volle zustumm! ... abgesehen davon, dass die perVersen zuweilen halbstundenlang darauf warten memussen, ehe wieder mal ein kellner auftooch, um nach fehlenden getränken zu schauen: auch das essen in der zuvor hochgelobenen dammmühle war eher nur von durchschnittlicher qualität ... bratkartoffeln, die nicht kross sind und nach gebrauchtem fett schmecken? ... absolutes geht-nicht (no go)! ... darüber hinaus war auch in diesem etablissement eine in marburger restaurationen offensilcht häufig verbrittene eigenheit zu beobachten: das eigelnt VOR bzw. wenigstens MIT dem hauptgericht zu bringende speisen erst geraume zeit NACH diesem auf den tisch gebracht werden ... in der dammmühle so geschehen mit den salaten ... daher auch hier die bereits von kilian in der "sonne" ahln erwuhnene beschreibung: salat NACH hauptgericht ... fazit: wanderer, kommst du nach marburg,  bleibe der dammmühle fern!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-28, 12:34:48
Ach ja, und die Hälfte der Einträge der Speise- und Getränkekarte war "aus".
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-28, 12:52:36
Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Wenn ich recht aufgepossen habe, werden solche Kleinteile doch nach ihren Postulanten benonnen (siehe Higgs-Boson). Nu weiß ich aber nimmer, wer erstmals die Forderung stall, war es Karsten, der Chef, Günter? Ich war es nicht, denn ich verstehe nix von Füsick.
Entsprechend gälte es vorabstens zu klären, ob das Fleischer-Boson, das Evang-Boson oder gar das Gans-Boson nachzuweisen wir uns an die Arbeit machen sesüllen. :-\
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-28, 13:00:39
Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Das ist ein nobelpreisverdächtiges Postulat. Die Existenz des Sprachbosons muss im Standardmodell der Sprachpartikel gefordert werden, um die Malitation der Sprache zu erklären, denn ohne es würde allen Sprachpartikeln die Bosheit 0 zukommen.

Das ist absolut richtig! Begönne man mit dem ersten Versuchsaufbau, memüsse man doch ein wirklich boshaftes Wort (zunächst der deutschen Sprache) untersuchen. Leider - und hier liegt schon der erste Hase im Salat - kenne ich kein wirklich boshaftes Wort, außer vielleicht: ALKOHOLVERBOT :P
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-28, 15:42:39
Ach ja, und die Hälfte der Einträge der Speise- und Getränkekarte war "aus".

... genau, und das am samstagabend 19 uhr, lange bevor die dammmühle voll war! ... eine enttausch auf der ganzen linie! ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-28, 15:48:28
Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Wenn ich recht aufgepossen habe, werden solche Kleinteile doch nach ihren Postulanten benonnen (siehe Higgs-Boson). Nu weiß ich aber nimmer, wer erstmals die Forderung stall, war es Karsten, der Chef, Günter? Ich war es nicht, denn ich verstehe nix von Füsick.
Entsprechend gälte es vorabstens zu klären, ob das Fleischer-Boson, das Evang-Boson oder gar das Gans-Boson nachzuweisen wir uns an die Arbeit machen sesüllen. :-\

... da in der GSV eh alles anders ist, wäre mein vorschlag zur güte: wir nennen das dingens vorerst X-boson, die endgültige benums erfolgt nach demjenigen, der das ding nicht nur nachweist, sondern auch noch passend in die große sprachformel einbaut ... denn diese ist ja jetzt das neue große ziel, wo der grobe duben weiterhin sanft schlummert ...

... im übrigen brachte amarillo diesbezulg am sonntagmorgen auch ein völlig neues teilgebiet der linguistik, die thermolinguistik , ins spiel ... ich habe indes vergessen, was deren erster hauptsatz besug ???
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-28, 16:26:49
Help is on the way:

Es gibt der Hauptsätze vier:

1. Wenn ein Sprachsystem A sich mit einem Sprachsystem B und System B sich mit einem Sprachsystem C im linguistischen Gleichgewicht befindet, so befindet sich auch A mit C im linguistischen Gleichgewicht. Die Zustandsgröße, die bei diesen Systemen übereinstimmt, ist 'wb' (wie bitte?).

2. Die monemische Energie eines geschlossenen Systems ist konstant - solange keine Frauen mitpalavern. (Siehe auch: Interpunktionserhaltungssatz)

3. Linguistische Energie ist in beliebigem Maße in andere Energieformen umwandelbar (z. B:: "Herr Ober, zwo Obstler bitte." -> Linguistische Energie wird in den Energieträger C2H5OH umgewandelt).

4. Den absoluten Nullpunkt linguistischer Energie bildet das 'betretene Schweigen'.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-28, 21:03:57
... sei hiermit schon einmal festgestollen, dass marburg wohl die perVers mit dem besten wetter, den meisten stufen und den weitestgeriesenen gästen war ...
Darfsch dem Auftberagenen für Detailkorrigur, Berachtog & Ergonz diesen einschenken:
Weitest geriesenste PerVerse waren wohl Agricola (Route Tokio-Mainz), Kilian (Groningen-Wien) oder Bertl (Wien-Eisenach). Ohne Atlasgucken meinsch, Groningen-Marburg töppe dies nit.

... du hast recht, hier war ich wohl etwas zu voreilig mit den superlativen ... asche auf mein haupt ... ich versuche das nächste mal nacheilig zu sein ;)
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:23:13
Das ist ein nobelpreisverdächtiges Postulat.

Früge sich nur: phyr Teilchenfüßig oder Litteratur?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:32:21
Wir formuloren den Interpunktionserhaltungssatz, dem zufolge z.B. vergessene Kommata stets an anderer Stelle als falsche Apostrophen wieder auftauchen.

Gegen den postul georenen Interpunktionserhaltungssatz spräche jedoch das allmähle, schleichende Verlustiggehen des Strichpunkts. Auf diese Bemurk bekamen einige von uns Semikoliken.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:34:26
Der Dammühle ist insgesamt kein hervorragender Service zu attestieren. Zum krönenden Aufschluss fulg auf Jennys Bestellung eines schwarzen Tees statt eines solchen die Wiedervorlage eines dem Geschmack nach zu urteilen bereits benotzenen Teebeutels. Recycling in allen Ehren, aber. Nach Reklamation dauerte es noch lange, bis es behoben war.

... volle zustumm! ... fazit: wanderer, kommst du nach marburg,  bleibe der dammmühle fern!

Ebentpfalz Zustumm. Anxichz gehobener Erwurtte an die Küchenkunst der Dammühle empfanden sich nicht alle PerVersen als diesbezülg sonderl beglocken; bsonders die Wildgulaschgeorderthabenden kompfen mit der ein oder anderen vom Koch übersehenen Sehne, und ein Kartoffelknödel dazu, der versehelnt in gezuckerten Bröseln (wohl für Germknödel) geschmolzen ward, geht gar nicht.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:35:37
Ach ja, und die Hälfte der Einträge der Speise- und Getränkekarte war "aus".

Stümpt – "hammwanich" hatte ich zuletzt in der untergehenden DDR 1989 gehoren.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:39:02
Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Wenn ich recht aufgepossen habe, werden solche Kleinteile doch nach ihren Postulanten benonnen (siehe Higgs-Boson). Nu weiß ich aber nimmer, wer erstmals die Forderung stall, war es Karsten, der Chef, Günter? Ich war es nicht, denn ich verstehe nix von Füsick.
Entsprechend gälte es vorabstens zu klären, ob das Fleischer-Boson, das Evang-Boson oder gar das Gans-Boson nachzuweisen wir uns an die Arbeit machen sesüllen. :-\

I woa's gwiß aa ned. Ich und Füßig? Gnade dem Teilchenbeschleuniger.  *blush*
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:43:16
Wir beschlossen weiters, ein Sprach-Boson zu postulieren, das eventuell dereinst in einem Silbenbeschleuniger o.Ä. nachgewiesen werden kann.

Das ist ein nobelpreisverdächtiges Postulat. Die Existenz des Sprachbosons muss im Standardmodell der Sprachpartikel gefordert werden, um die Malitation der Sprache zu erklären, denn ohne es würde allen Sprachpartikeln die Bosheit 0 zukommen.

Das ist absolut richtig! Begönne man mit dem ersten Versuchsaufbau, memüsse man doch ein wirklich boshaftes Wort (zunächst der deutschen Sprache) untersuchen. Leider - und hier liegt schon der erste Hase im Salat - kenne ich kein wirklich boshaftes Wort, außer vielleicht: ALKOHOLVERBOT :P

Wie wär's? Nennen wir's Hicks-Bosom?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-28, 23:58:10
@ Restaurantgemäkel:

Amarillo will sogleich – wahrlich kritische – Restaurantkritiken bei tripadvisor.de oder so ablassen.

Ich bin dergln ebenfalls zugeniegen. Gäbe es Geruchs- oder Geschmacks-Internet, süge ich den Dammühlen-Köchen anschmex Ruths (Stefans Fraus) sonntälg-abelndem Privatmenü: So geht Wild! (Wildschweinrückenfilet aus nahem Beschuss in Kräuterkruste, 4 Stunden bei 80 Grad rosa geschmoren, dazu sämige, kraftvolle Sauce, Spätzle von eigenem Brette handgeschaben, würzigschärflichsüß eingelegte Kürbiswürfel, Feldsalat auf eingelegter Würzroterbete, dazu ein Châteauneuf-du-Pape 2007 – aaahhh...)
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-29, 00:01:09
Weniger oder eher mehr zusammenhanglose Notate aus der Dammühle:

Kubertulose = schwelende bis lodernde Dissonanz zweier GSV-Mitglieder.

Abschwiff: Auto-Tourette ist, wenn man im Auto schimpft ("Fahr zu, du Depp! Grüner wird's nicht!") oder morgens verkatert in den Spiegel schaut ("Oh, ich A...loch!").
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-10-29, 00:06:18
Abschied von der Dammühle, abermals unter den Zeichen von Orienturlosik und allgemeiner Verwurr:

Mittelschweres Tohuwabohu bezülg der Bestull eines Großraumtaxis zwecks leicht überstorzener Rückkutschur in die Stadt.

Zitate, auszugweise plagi georen: "Isch han kein Netz!" – "Isch aa net!" – "Wer hat denn eigelnt die Telefonnummern von diesen Taxis?!" Allfällige Betatog des Panic Buttons.

Berohag der Truppe durch Verabriech einer weiteren Runde Şprufki in felstem Rahmen: unterm Partyzelt Dammühlens Innenhofs an weiß gedocknen Stehtischen, très chic.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-29, 10:33:19
Wir formuloren den Interpunktionserhaltungssatz, dem zufolge z.B. vergessene Kommata stets an anderer Stelle als falsche Apostrophen wieder auftauchen.

Gegen den postul georenen Interpunktionserhaltungssatz spräche jedoch das allmähle, schleichende Verlustiggehen des Strichpunkts.

... nein, nein! ... dies spricht überhaupt nicht dagegen! ...

... wenn ich kurz rekatapultieren, neee: rekatakurieren ;D darf: der interpunktionserhaltungssatz besagt, dass die menge der interpunktionszeichen (in der deutschen sprache, in allen sprachen, im universum? @ kilian: wie waren wir hier verblieben? ... sicherlich im universum, oder? :D) stets gleich bleibt und zeichen, die irnxwo verlustig gehen, anderswo in ggf. verorndener form auftauchen ...

... bei den semikola ist es nach neuesten forschungen so, dass diese durch nichtgebrauch in ihre bestandteile zerfallen (ggf. auch unter dem einfluss der hix-bosonen?) ... die striche werden sodann zu "deppenkommata" (z.B. in: Trotz umfassender Reformbemühungen der griechischen Regierung, verlieren Anleger das Vertrauen in Griechenland.), während die losgelosenen punkte sich oft zu dreiergruppen formieren und als auslassungspunkte in die online-texte von katakura wandern ;D

Wie wär's? Nennen wir's Hicks-Bosom?

... ja, da "hick" ja auch eine nicht selten auftretende lauturß ist, fände ick Hicks-Boson passend ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Wortklauber am 2012-10-29, 11:06:25
Und was passiert mit den zu Smilies umgewandelten Satzzeichen? (Ich meine z.B. ;) Zählen die Smilies auch oder tauchen die versmilten Zeichen woanders wieder auf?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-29, 11:09:19
An dieser Stelle sei von meiner Warte aus dem geschotzenen katakura beigepflochten.

Neuester nano-linguistischer Forschung zufolge ist die Zahl der Interpunktionszeichen seit dem Urknall konstant.
Ich persoln bin Anhänger der These, daß das Hicks-Boson in der Lage ist, nicht nur Semikolöne zu spalten, sondern es auch schafft, ein schlichtes Komma in Akzente, Tremata, Cédilles, Weichheitshäkchen und alle anderen diakritischen Zeichen umzuwandeln. Wie es das tut, bleibt zu erforschen. Ist schon ein Teufelskerl, dieses Hicks-Bösönchen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-29, 12:09:53
Und was passiert mit den zu Smilies umgewandelten Satzzeichen? (Ich meine z.B. ;) Zählen die Smilies auch oder tauchen die versmilten Zeichen woanders wieder auf?

... die versmilenen zeichen müssen erst mal irgendwoher kommen, was vergleichsweise leicht zu erklären ist: seit scott fahlmann 1982 estmals smileys mittels ascii-zeichen darstoll, ist ein rückgang nicht nur der kommata und semikola , sondern auch der bindestriche (z.B. bei zusammensetzungen wie "Back Shop" oder "Dipl. Ing.") ver zu zeichnen ... klarer fall: die werden für smileys gebroochen ... woher indes die gebogenen klammern für die smileys kommen, ist noch nicht abschließend gekloren... meine fursche deuten darauf hin, dass sie ursprulng gedanken- und streckenstriche sind, die zunehmend durch einfache bindestriche ersotzen werden ...

... noch ist jedoch unklar, ob hier tatsalch eine reine ersotz der langen durch die kurzen striche stattfindet, oder ob sich die langen striche unter dem einfluss von hicks-bosonen verkürzen, wobei sich die abgespaltenen endstücke anderswo wieder zu neuen zeichen zusammenfinden (vielleicht eben gekrummen als gebogene klammern für smileys?) ...

... ich hoffe, ich verrate jetzt nicht zuviel, wenn ich sage, dass die GSV derzeit unter dem bibliodrom den ersten zeichenbeschleuniger (nicht silbenbeschleuniger, wie kilian irrtulm schrieb) bauen lässt, der im kommenden jahr in betrieb gehen soll ... die dann molgen experimente u.a. auch mit den vom renommorenen kollegen amarillo erwohnenen diakritischen zeichen werden, so zeie ich proph, einen quantensprung für die nano-linguistik bringen! ... und, letzten endes, der GSV mit großer sicherheit den nobelpreis! ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Stollentroll am 2012-10-29, 14:43:02
Die Suche ist beendet :

Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-29, 14:56:13
Das Trema wird zum Doppelpunkt,
das Komma rutscht nach oben.
Wenn's Hicks-Boson dazwischenfunkt,
wird oftmals Stuß mit Sinn verlunkt,
der nimmer ward erstroben.

Gedankenstrich zu Circonflexe,
zu Apostrophen Tilden,
der Leser bleibt zurück - perplex,
hysterisoren ob des Schrecks
und wähnt sich unter Wilden.

Das alles schafft ein Hicks-Boson,
ein kleines, fieses Wesen.
Die Existenz scheint klarer schon,
die Weise jedoch der Funktion:
bislang nur vage Thesen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-29, 15:47:11
... ich weiß nicht, ob kilian seinen bericht über den samstagabend schon abgeschlossen hat ... wenn ich ihm hiermit vorgreifen sollte, so bitte ich um enthuldigung ;) ...

... was mir bislang noch fahl, war die erwuhn des beschlusses, der GSV demnächst endlich zweierlei zu geben:

1) eine fahne (ohne rechte winkel)
2) eine hymne

... für 1) kann jeder, der sich berufen fühlt, entwürfe einreichen ... auf alle fälle sesülle idealerweise bis zur nächsten neutsch-wallfahrt im frühjahr 2013 das banner fertiggestollen sein, damit unser neutsch-wallfahrts-bannerträger ku es vorantragen kann, wenn die gsv zum lärmfeuer in neutsch einrückt :) ...

... für 2) ward der poeta laureatus der GSV, amarillo (wieso führt er eigelnt noch immer nicht offiziell diesen titel? kann ich dessen verleihung hiermit post-perVers beim geliebten sprachführer antberagen? verdenen hat amarill diesen titel nun schon mehrfach), auftberagen, zu einer molgst bekannten, gema-freien melodei (altes deutsches volkslied?) einen maximalst deuhochneutschen text zu dichten ... ggf. werden von ihm ein paar kernstrophen vorgegeben und jeder, der sich berufen fühlt, kann weitere strophen dazudichten, bis die hymne ahln lang und lustig wie das wal-epos um albert ist ... kekünne zumindest ich mir gut vorstellen, wie quasi alle aufgaben, denen wir uns widmen (siehe wiki), in vierzeilerform verwursten werden ...

... und 3) möchte ich hiermit anregen, dass wir bis zur nächsten perVers einen perVersen eid entwerfen, der zur offiziellen eronff der perVers vom jeweiligen pompabtielvollmbeachtogenen namens aller perVersen gesprochen werden sesülle ... das wäre hehr, knapp und treffend und löste das immer wieder auftauchende problem der eröffnungsrede ein für allemal auf elegante weise ... mein entwurf dazu (in anlahn an den olympischen eid):

Im Namen aller PerVersen verspreche ich, dass wir an der PerVers teilnehmen und uns während ihrer Dauer eines Neutschs ohne schwache Verben befleißigen, im wahren Geist der maximalst molgen Unverstalnd, für den Ruhm unseres geliebten Sprachführers und die Ehre der GSV.

... dies nur als erstentwurf ... den vielleicht noch fehlenden passus mit der vernichtung aller im weg herumstehenden alkoholischen getränke bzw. des sprufkis möge vielleicht amarillo noch einbasteln :D ...

... hab ich noch was vom samstag vergessen? ... wurden nicht auch noch ein paar weitere ämter vergeben?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-29, 17:05:53
(...)
@Bertl: Den Panic-Button kann man amazonal bestellen. (...)

Danke für die Info, lieber Fleischers Karsten! Gleich Pan und die Amazonen. Also ein mythologisch aufgeladener Knopf.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Stollentroll am 2012-10-29, 18:16:36
... woher indes die gebogenen klammern für die smileys kommen, ist noch nicht abschließend gekloren

Dazu gibt es eine Theorie des amerikanischen Zeichenphysikers Dr. Sheldon Cooper.
Cooper postuliert für das Schreiben von Texten eine maximal erreichbare Zahl von Anschlägen pro Minute, die Bertl-Konstante. Je weiter sich ein Schreiber dieser Konstante annähert, desto mehr kommt es zu einer Krümmung im Zeit-Zeichen-Kontinuum, die dann zur Entstehung von gebogenen Klammern führt.
Hier kommt dann euer Hicks-Boson ins Spiel, denn nur ein solches massereiches Teilchen kann durch seine Anziehung die Entstehung von geschwiffenen Klammern erklären.
Zudem besagt Coopers Theorie, dass ein Schreiber nahe der Bertl-Konstante schneller schreibt als ein Leser auf der Erde denken kann.
Der interessanteste Effekt entsteht beim Erreichen der Bertl-Konstante : Der geschriebene Text wird schlagartig maximalst unverständlich, ändert seinen Aggregatzustand von solide nach überflüssig und verschiebt sich durch das nächstgelegene Wurmloch nach "Abschwiffe".

Wie wäre es mit einem eigenen Faden : "Hicks-Boson, Thermolinguistik und Die Grosse Sprachformel" ?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-29, 18:33:33
(...)
Der interessanteste Effekt entsteht beim Erreichen der Bertl-Konstante : Der geschriebene Text wird schlagartig maximalst unverständlich, ändert seinen Aggregatzustand von solide nach überflüssig und verschiebt sich durch das nächstgelegene Wurmloch nach "Abschwiffe".
(...)

Ich sehe auch echt keinen Grund, als Lektor, Dissertationsüberarbeiter und Korrektor diverser Pfappleiche von StudentInnen und/oder FreundInnen (welchselbige schon wissen werden, weshalb sie da just mich fragen), allüberall jenen klaren, pädagogischen & unbestechlichen (: na, denen wohl schon) Richtlinien zu folgen.
Der Mensch steckt doch auch auch voller Wildnis.
Zitat: "Kein Ding sieht so aus, wie es ist. Am wenigsten der Mensch, dieser lederne Sack voller Kniffe und Pfiffe." - Wilhelm Busch, Von mir über mich (1894).

Kenne zwar keinen, der nach den Überträgen unter "Abschwiffe" Euch noch eines weiteren Beitrages gewurdagen hätte. - Nun seid Ihr aber halt meine verohrenen, lieben Freundinnen & Freunde, die's auf der Welt auch nicht immer leicht haben ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-29, 19:36:54

Der geschriebene Text wird schlagartig maximalst unverständlich, ändert seinen Aggregatzustand von solide nach überflüssig ...".

Für füsickalische Laien wie mich: Ist 'zäh' eine Sonderform von 'solide'?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Wortklauber am 2012-10-29, 19:49:01
... was mir bislang noch fahl, war die erwuhn des beschlusses, der GSV demnächst endlich zweierlei zu geben:

1) eine fahne (ohne rechte winkel)

Erledigt das nicht der Spufki?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Wortklauber am 2012-10-29, 19:50:48
... was mir bislang noch fahl, war die erwuhn des beschlusses, der GSV demnächst endlich zweierlei zu geben:

1) eine fahne (ohne rechte winkel)

Erledigt das nicht der Spufki?

... Sprufki
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Wortklauber am 2012-10-29, 19:52:00
Im übrigen wird dem Sprufki auch nachgesugen Punkte zu Doppelpunkten zu spalten und damit gegen Naturgesetze zu verstoßen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-10-29, 19:53:46
Kenne zwar keinen, der nach den Überträgen unter "Abschwiffe" Euch noch eines weiteren Beitrages gewurdagen hätte.

Ich kenne auch keinen, der dich nach deiner anhaltenden Trollerei hier noch hätte posten lassen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Stollentroll am 2012-10-29, 20:04:15
Für füsickalische Laien wie mich: Ist 'zäh' eine Sonderform von 'solide'?

Entscheide selbst ! (http://www.duden.de/rechtschreibung/zaeh)
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Stollentroll am 2012-10-29, 20:15:31
Im übrigen wird dem Sprufki auch nachgesugen Punkte zu Doppelpunkten zu spalten und damit gegen Naturgesetze zu verstoßen.

Wahrscheinlich enthält Sprufki Unmengen von Hicks-Bosonen. Müsste man mal den Ganter fragen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-29, 23:40:04
... woher indes die gebogenen klammern für die smileys kommen, ist noch nicht abschließend gekloren

Dazu gibt es eine Theorie des amerikanischen Zeichenphysikers Dr. Sheldon Cooper.
Cooper postuliert für das Schreiben von Texten eine maximal erreichbare Zahl von Anschlägen pro Minute, die Bertl-Konstante. Je weiter sich ein Schreiber dieser Konstante annähert, desto mehr kommt es zu einer Krümmung im Zeit-Zeichen-Kontinuum, die dann zur Entstehung von gebogenen Klammern führt.
Hier kommt dann euer Hicks-Boson ins Spiel, denn nur ein solches massereiches Teilchen kann durch seine Anziehung die Entstehung von geschwiffenen Klammern erklären.
Zudem besagt Coopers Theorie, dass ein Schreiber nahe der Bertl-Konstante schneller schreibt als ein Leser auf der Erde denken kann.
Der interessanteste Effekt entsteht beim Erreichen der Bertl-Konstante : Der geschriebene Text wird schlagartig maximalst unverständlich, ändert seinen Aggregatzustand von solide nach überflüssig und verschiebt sich durch das nächstgelegene Wurmloch nach "Abschwiffe".

bruu ... bruu ... bruuuhahahaha!!!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-29, 23:50:41
Wie wäre es mit einem eigenen Faden : "Hicks-Boson, Thermolinguistik und Die Grosse Sprachformel" ?

... fände ich gut, allerdings memüsse auch die nano-linguistik unbedongen mit in den titel ... vielleicht kann kilian ja die betreffenden sachen entsprechend umhieven (sofern sich das hier noch aus dem perVers-faden ausklamüsern lässt)? ... und wenn wir noch ein paar mehr theorien, postulate und theoreme ausgesponnen haben, reicht es bald schon für eine eigene neue rubrik im wiki ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Beck Messer am 2012-10-30, 01:13:21
Kenne zwar keinen, der nach den Überträgen unter "Abschwiffe" Euch noch eines weiteren Beitrages gewurdagen hätte ...

Aber daß Du dem guten Beispiel gefolgt wärest - so viel Glück hatten wir dann doch nicht. ;D
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Gast Ronom am 2012-10-30, 10:29:26
Da eines meiner Gedichte in einer Sonderausgabe in Goode Aulde Dschöameni veroffentlochen werden wird (Adventzeit; Ihr kennt es eh!), bin ich heute nicht böse zu stimmen. Glaubt mir, wir fahren hier besser zusammen. Stichwort: "Ghuiddua"! Und Du, lieber Stollentroll: Sesüllest Du einmal Wien besuchen, dann sei in meine weiten Arme geschlossen! Bist, bei aller Schärfe, ein urlieber Kerl!

Ich fahre regelmäßig zusammen, wenn ich dergleichen lese!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-30, 10:40:06
Da eines meiner Gedichte in einer Sonderausgabe in Goode Aulde Dschöameni veroffentlochen werden wird (Adventzeit; Ihr kennt es eh!), bin ich heute nicht böse zu stimmen. Glaubt mir, wir fahren hier besser zusammen. Stichwort: "Ghuiddua"! Und Du, lieber Stollentroll: Sesüllest Du einmal Wien besuchen, dann sei in meine weiten Arme geschlossen! Bist, bei aller Schärfe, ein urlieber Kerl!

Ich fahre regelmäßig zusammen, wenn ich dergleichen lese!

Dann ersetz ich "fahren" halt durch "reisen". Na und?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-30, 10:41:09
Da eines meiner Gedichte in einer Sonderausgabe in Goode Aulde Dschöameni veroffentlochen werden wird (Adventzeit; Ihr kennt es eh!), bin ich heute nicht böse zu stimmen. Glaubt mir, wir fahren hier besser zusammen. Stichwort: "Ghuiddua"! Und Du, lieber Stollentroll: Sesüllest Du einmal Wien besuchen, dann sei in meine weiten Arme geschlossen! Bist, bei aller Schärfe, ein urlieber Kerl!
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-30, 10:51:01
... mein abgrundguter berthold, erklärst du bitte mal den sinn dieser sperenzchen? ... wieso schreibst du einen beitrag (10:13), wartest die reaktionen (10:29) ab, löschst ihn wieder und setzt ihn erneut UNTER die reaktionen (10:41)? ... ich glaube wirklich, für dich brauchen wir doch irgendwann noch ein paar extra forumsregeln >:(
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-30, 11:24:18
... mein abgrundguter berthold, erklärst du bitte mal den sinn dieser sperenzchen? ... wieso schreibst du einen beitrag (10:13), wartest die reaktionen (10:29) ab, löschst ihn wieder und setzt ihn erneut UNTER die reaktionen (10:41)? ... ist das die bloße eitelkeit, willst du unbedingt das letzte wort behalten, möglichst oft auf dem allgemeinen board mit deinem namen auftauchen, oder was soll das? ... ich glaube wirklich, für dich brauchen wir doch irgendwann noch ein paar extra forumsregeln >:(

Ich hab den Beitrag nicht golontsch. Er ist einfach verschwunden. Dann fand ich ihn halt zinnor - und dachte: Verschwinden soll mein Beitrag auch wieder nicht. Durch keinen Gast "Gast Ronom", den hier kein Ameisenbär* kennt. Außerdem wird darin der Stollentroll ein "urlieber Kerl" geheißen.
Besonders eitel bin ich auch nicht. Auf was kann ich in meiner Lage eitel sein? Außerdem hast Du doch selber letztens weit, weit mehr Zeilen herguschrimp als ich. Marburg, klar, eh!
&: Verbirg Dich nicht hinter einem kollektiven "wir", von dem Du Zungstamm erwartest! Wollma doch nix von einem Spruch hören, den ich einem Sommergast am Weissensee (Kärnten) einstens auch nur unterschob: "Wir Deutschen, wir sind doch die tollsten Apparate, wa!?"
Alles - oder doch vieles - klar?

*Damit es nicht immer die Sau sei.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-10-30, 11:39:37
... ja, schon recht ... ich gehöre eben auch nur zu den bösen piefkes, die dich armen ösi hier bloß immer unterdrücken wollen ... oh mann ::) ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-30, 11:53:11
... ja, schon recht ... ich gehöre eben auch nur zu den bösen piefkes, die dich armen ösi hier bloß immer unterdrücken wollen ... oh mann ::) ...

Lieber katakura! Mr. "bruu ... bruu ... bruuuhahahaha!" (Schriftgröße 18. - Da ging's über mich.)

Eben das war ja hier echt nicht Ernstens gnumien, das genau nicht ... ach weib ...
Über dieses "oh mann" oder "mann-o-mann!" wäre auch einmal ein Pfappleich klass.
Nicht dünken mich aber Schriebe von Nöthen, die sich dann, wenn einander zwei, echt lebendig, gegenüberstehen, flugs in Wohlgefallen auflösen. Wie denn auch nicht? Damit poche ich auf eine Art von 56-jähriger Altersweisheit, durch diverse, +/- längere, Spitalsaufenthalte noch aufgepforffen.   
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-30, 13:49:18
(...) sperenzchen ... (...)

Ein nettes Ösi-Süno ist 'Spompanad(e)ln'.
Ich fand: <<von ital. 'spampanare' = entlauben, entblättern > 'spampanata': das Auslichten des Weinstockes. Irgendwie übertragen > "Aufschneiderei">>
http://www.ostarrichi.org/wort-1721-at-Spompanadeln.html
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-10-30, 14:53:05
Kenne zwar keinen, der nach den Überträgen unter "Abschwiffe" Euch noch eines weiteren Beitrages gewurdagen hätte.

Ich kenne auch keinen, der dich nach deiner anhaltenden Trollerei hier noch hätte posten lassen.

Tja & knirsch, lieber Kilian, Strafe wider mich wird sein müssen. - - -
Ich will nun nicht die belittag'ne Leberwurscht spielen und angeberisch brümmeln, daß eins aus guten Zoos nicht ausgeronchen den Großpanda aussperrt.
Quatsch!
Laß mich Euch halt, schreiben wir - - - nächstens, urbescheiden, durchs moosgrüne Wiener Neustadt führen. - - - Ist doch ein offaires Angebot, ein wahres Anerbieten, was?
Seht hier "mein" altes Bundesgymnasium und einen kleinen Teil der Stadtmauer mit dem Reckturm:
http://www.bg-bab.ac.at/index.php?id=77
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-10-31, 13:33:53
Las ich nicht vor wenigen Stunden noch einen überaus treffenden Beitrag des Kollegen GüGa hier?
Wo ist er hin, der Beitrag?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 03:53:27
Den hab ich alsbald wieder geloschen, weil mir die Wortwahl doch zu scharf schien – wenn eins ein ausgewiesenes Psycherl hat, muss man ja nicht extra foral nachtreten. Mein Zorn ist schon wieder verroochen...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 03:56:28
Wo ist er hin, der Beitrag?

Auf bsondern Wunsch: Unterwegs in Dein Postkastl und mainzwegen zur Zitur (ob mit oder ohne korrektem/n Quellennachweis, mit oder ohne Gänsefüßchen: Mir doch egal, ich seh das nicht so eng, ist ja keine Wissenschaft) freigegeben.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 04:07:40
Und damit zu etwas völlig anderem, nälm der postperVersen Chronistenpflicht: Was war noch perVers?

Samsspätabenz ward Jenny müdikhalber hotelens eingelurfen; es verkniepen sich amarillo (veaulle aus studentisch-reminiszierlichen Gründen), Karsten und – erstaulnerweis' – der Senior Gangsta Rapper in den Hinkelstein, welcher bis 29 Uhr geonffen, derweil der Rest in der netten Bar "Paprica" einkniep. Lärms und rauchs entfloh Ku alsbald gen Heia, worauf amarillen und Karsto nach gsmsnem Kontakt herauftreppelten & sich papricens* anschlossen. Gutes Köstritzer Schwarzbier, hübsch anzuschauende wilbe Personäle & Gästinnen. Empfehlenswertes Lokal. Weiters ausgiebiges Geblold, wenn auch mit stark dezim georener Prolokollführung. Zirka 26 Uhr Abverschod, Heiamachen.

*) Von dort – statt Bücherstapeln – mülnde Lesetipps, des Homers, wenn ich nicht örre:
Flann O'Brien: Der dritte Polizist
David Lodge: Changing Places (und andere Campus-Romane)
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 04:12:31
Vom Sonntagmorgen happich – wg. Morpheus – nix mitbekommen, dafür später doch noch den Spiegelslustturm (http://www.google.de/search?q=spiegelslustturm+marburg&hl=de&prmd=imvns&tbm=isch&tbo=u&source=univ&sa=X&ei=BNOOUJmkMIjysgajxIDgBQ&ved=0CDsQsAQ&biw=1600&bih=694) besachtogen – da happter 'ne Aussicht versommen, und ein womolg noch geschmacksverorreneres modernes Anbauteil als die elisabethanische Orgel – Zitat dazu: "Am 1. Dezember 2006 wurde am Spiegelslustturm eine Lichtinstallation der Marburger Künstlerin Helmi Ohlhagen angebracht. Sie zeigt ein stilisiertes Herz und wurde anlässlich des Elisabethjahres am 1. Januar 2007 in Betrieb genommen. Durch einen Anruf bei der kostenpflichtigen Telefonnummer 09005-771207 wird das Lichtbild aktiviert. Die Nettoeinahmen durch die Gebühren (99 Cent pro Minute) kommen zu 100 Prozent gemeinnützigen Einrichtungen zugute."

Immerhin für 'nen guten Zwack.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 04:19:20
Zu kynvtgen PerVers-Austragsorten warden – nach Wien – weitere nahe Auslandsfilialen insauggefossen, alldieweil dort jeweils mehr oder weniger ulke neutsche Dialekte gepflogen werden, alsda wären: Luxemburg/Luxemburg, Eupen/Belgien, Bozen/Südtirol/Italien, Basel/Schweiz. Leider haben wir immer noch keine Mitgleider von daher und insofern*, wowelchene als Cicerone** fing fung ieren kekünnen...

*) Dies derzeit häuf zu hörende dälme Modewort memusste irgendwie untergebrochen werden.

**) Schmöchtmich nächstmals von diesem Amt absent ieren, es überfrörde meine Orienturfah doch deult. Liefe es auf eine dieser Städte hinaus: In Luxemburg bin ich nur mal durchgefahren, in Eupen war ich noch nie, in Bozen und Basel letztmals vor Jahrzehnten...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 04:22:05
Vorlaufendes persolnes Fazit zur Fumfzen – ohne den werten anderen Mitwirkendinnen und Mitwirkenden vorgreifen zu wollen:

Eine großartige, hoch lustige PerVers in einem schönstens beworttenen, äußerst lauschigen und sehenswerten Städtchen, eine PerVers im Zeichen der Panik, der Hysterie und der Orientur- und Entschlusslosik. Gerne mehr davon im Fryhlink 2013.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-01, 06:43:42
(...) Auch auf dem Marsch war es, dass Günter den Begriff des "militanten Provinizialismus" zur Wahl unserer Versammlungsorte prug, (...)

Just SO soll es sein - wenn ich an die Theresianische Militärakademie in Wiener Neustadt denke, der Welt älteste Militärakademie, eine wahre
Kader(Kater?-)schmiede! - :
http://www.bmlv.gv.at/karriere/offizier/index.shtml
(Dies schrieb ein Sieche-gepflogabender Zivildiener.)

Schglaube, Bertl ist hier die Begriffe "militanter Provinzialismus" und "provinzieller Militarismus" am durcheinander am kriegen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-11-01, 09:51:06
Großartig, damit ist das Protokoll ja fast komplett. Was ich im "Coyote Ugly Marburgs" (so ein Bezinch fürs "Paprica") noch notor, ist alles irgendwie inkonklusiv, das kommt wohl vom vielen Kölsch. Erwähnenswert scheint mir, dass wir ein neues Forschungsfeld für die Adynata (http://irrelevanz.de/Dokumente/Forschung_Kleinforschung_adynata.html) erschlossen: die Rezeption Loriots im internationalen Vergleich. Hin und wieder harrsch Panik über das mögliche versehentliche Drücken des Panikknopfes. Der Jubiläumstag der GSV wurde auf den umpfzehnten Nozember festgesotzen. Wir sponnen über das Wort willfährig herum und überlogen, ob man eine Willfahrt unternehmen kann. Und eine sprachliche Perle aus einer Telefonwarteschleife ward referoren: "Der gewünschte Gesprächspartner spricht. Bitte warten Sie, Sie sind angeklopft." Hier reißen die schrilften Zeugnisse ab, doch erinnere ich mich an heiteres Bergabwanken, da alle drei zuletzt verbliebenen PerVersen (Günter, Karsten und Le Me) in ähnlicher Richtung nachtogen. Auf meine Hotelrezeptionistin muss Günter einen sehr bedrohlichen Eindruck gemachen haben, so resolut wies sie sein Ansinnen, ein Taxi rufen oder rufen zu lassen, ab, ohne es auch nur angehört zu haben. Mit verzögerter Reaktion gelang es mir dann, sie darauf hinzuweisen, worum es gehe - ich hoffe, die Droschke kam denn schlulß auch?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: amarillo am 2012-11-01, 10:01:04
Vielen Dank, lieber GüGa, das war eine höchst umfassende und amysante Chronistenleistung. Ich wüßte nicht, wer das besser kekünne als Du!
Haben wir nicht noch ein Ämtchen frei, sowas wie Hofchronist (o.Ä.)?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-11-01, 13:17:52
Zu kynvtgen PerVers-Austragsorten warden – nach Wien – weitere nahe Auslandsfilialen insauggefossen, alldieweil dort jeweils mehr oder weniger ulke neutsche Dialekte gepflogen werden, alsda wären: Luxemburg/Luxemburg, Eupen/Belgien, Bozen/Südtirol/Italien, Basel/Schweiz.
(...)

Ich darf an des lieben Kilians Bericht über die PerVers 12½ in Wien (Hochsommer 2011) erinnern:
http://verben.texttheater.net/forum/index.php/topic,3046.msg47385.html#msg47385
Selber hab ich damals noch ein bisserl was dazuguschrimp. Der liebe caru war damals auch zugegen. Bloßer Asketenfüße.
Das vielleicht Exotischste an Tautsch (Das "sch", etwa, wird durch einen Zusatzbuchstaben wiedergogemp) und für eine PerVers wäre jedenfalls einer der letzten Orte des "Zimbrischen" - etwa Giazza/Ljetzan in Norditalien (Veneto - I XIII comuni Veronesi):
http://www.meteo-europ.com/de/it/veneto/giazza-bilder.html
Was eins dort eher versteht, das ist wohl das Italienische ...
Der Ort ließe sich auch von Bozen, Verona (Bieraun) oder vom Gardasee - einispeermaßen - erreichen. Eine Anrege für eine wassenschuftle Ochskarrziehan in die Vogtei Weinätz.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Berthold am 2012-11-01, 16:48:44
Den hab ich alsbald wieder geloschen, weil mir die Wortwahl doch zu scharf schien – wenn eins ein ausgewiesenes Psycherl hat, muss man ja nicht extra foral nachtreten. Mein Zorn ist schon wieder verroochen...

So soll's sein!
Obwohl's mich ja nicht algeniert (= tangiert), weil wir einander immer schon - und erst recht seit "Brandstetter"'''s Weinstube" - prachtvoll verstanden haben (das ist nicht nur unter Cavalieren chlub, sondern die lautere, handaufsherzichte Wahrheit!), freut's mich irgendwie, daß ich KEIN ausgewiesenes Psycherl (mehr) habe, sondern daß ich vor zwei Jahren weit eher, des Verdachts auf ein Psycherl wegen, per Grantt*-TATÜÜTATAA!!!(?) im Hosp. auf der "B.G.H." eingewiesen ward.
Erhalte auch immer gern besondere, urgut guschrimpe Post, muß aber zugeben, daß es in meinem Postkastl bisweilen von schwer zu bezahlenden Inwoißen quillt - die oft nicht so schön verfießen sind. Ab & an gar die unpersönliche, 'maschinelle' Schreibe aus Anwaltssekretariaten. Eine Woche letzte Frist - und solcherlei ...  Ließe ich da jedesmal Zorn aufdampfen - Omei(n)omei(n)!
Seid ehrlich umurmen! Schade, daß ich nicht zu Marburg zugegen sein kekunn! Aber es wird schon wieder ...

*DIE Grantt (nicht: DER Grant) = die Rettung, der Rettungswagen
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-11-01, 18:34:39
Wo ist er hin, der Beitrag?

Auf bsondern Wunsch: Unterwegs in Dein Postkastl und mainzwegen zur Zitur (ob mit oder ohne korrektem/n Quellennachweis, mit oder ohne Gänsefüßchen: Mir doch egal, ich seh das nicht so eng, ist ja keine Wissenschaft) freigegeben.

Nun ist meine Neugierde aber weidlich angefachen: Was brachte sie in dieser Sache hervor, die Gantersche Formulurkunst?
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-11-01, 21:35:32
Danke an Günter und amarillo, von denen mich das Zensum nahezu gleitzeichig errich. :D
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-11-01, 23:16:04
Wo ist er hin, der Beitrag?

Auf bsondern Wunsch: Unterwegs in Dein Postkastl und mainzwegen zur Zitur (ob mit oder ohne korrektem/n Quellennachweis, mit oder ohne Gänsefüßchen: Mir doch egal, ich seh das nicht so eng, ist ja keine Wissenschaft) freigegeben.

Nun ist meine Neugierde aber weidlich angefachen: Was brachte sie in dieser Sache hervor, die Gantersche Formulurkunst?

... himmel, jetzt ist die meinige erst recht angefuchen! :-\
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-11-02, 11:11:55
Großartig, damit ist das Protokoll ja fast komplett.

... woahhh, nicht so schnell! ...

... was ist denn mit dem damm-mühlens vor allem zwischen dir, karsten und mir diskut georenen projekt eines datenbankbasorenen verneutschers / verbenstärkers auf der GSV-startseite? ... wo man als gast ein beliebiges verb eingibt und aus den tiefen unserer mittlerweile sehr umfangreichen tabellen die konjugorenen neutschen formen auftauchen?* ...

... das fände ich nach wie vor ein echt tolles projekt, da dann potentielle interessenten wirlchk auf der startseite schon ausprobieren kekünnen, wie das eine oder verb auf neutsch konjugoren wird ... geht das realis zu ieren? ... bzw. memüssen vorher die konjugationstabellen noch anderes aufberitten werden? ...

... man kekünne den verneutscher vielleicht in einem zweiten schritt auch auf substantive ausdehnen - die regeln für die vernutsch sind ja im wiki festgeschrieben ...

* für den fall, dass ein verb von uns noch nicht gestorken wurde, erschiene eine entsprechende meldung mit dem versprechen, dass das verb binnen einer woche gestorken und der datenbank hinzugefogen wird (unter der voraussotz, dass es wirlchk ein verb ist und nicht bloß eine sinnlose buchstabengruppe) ... vorteil auch für uns: vielleicht bekommen wir dadurch eine ganze reihe verben dazu ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-11-02, 12:02:12
Technisch ist das überhaupt kein Problem (schon spannender wäre da ein ohne eine manuell befullene Datenbank neue Verben stärkendes Programm, wovon Karsten und ich es hatten), ich setze es mal auf die Liste der am Wiki zu werkelnden Dinge. Priorität hat für mich jetzt aber erst mal der Ersatz der 1½ Jahre alten Starzeitennachricht durch etwas dem 10-Jährigen Jubiläum Angemessenes... dazu werde ich gleich mal einen neuen Faden öffnen...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-11-02, 12:14:50
Technisch ist das überhaupt kein Problem, ich setze es mal auf die Liste der am Wiki zu werkelnden Dinge.

... also da freue ich mich wirlchk drauf, wenn das klappt 8)

(schon spannender wäre da ein ohne eine manuell befullene Datenbank neue Verben stärkendes Programm, wovon Karsten und ich es hatten)

... uhh, das ist dann aber sicher nicht ganz leicht, zumal bislang ja auch der menschliche faktor entscheidend war, wie ein verb gestorken ward ... woher weiß die automatik, nach welchen regeln sie zu stärken hat? ... oder bietet sie dann einfach verschiedene varianten an (z.B. mit und ohne tmesis)? ... kekünne sicher auch spannend sein ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-11-02, 12:18:14
... soll ich vielleicht in den "sonstigen aktivitäten" bei "über uns" noch einen punkt bezüglich unserer forschungen an der großen sprachformel ergänzen? ... und sesüllen wir dazu eine unterseite anlegen, in der z.B. der interpunktionserhaltungssatz auftaucht? ... das ist doch zu schön, um im forum zu verschwinden ... wenn ja, wo memüsse dies einsort georen werden? ...
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Kilian am 2012-11-03, 19:56:27
Nur zu. Ich finde, dies pieße gut unter "Grammatik".
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Ku am 2012-11-14, 14:54:27
Mir fällt gerade noch was wichtiges zur Chronik der PerVers in Marburg ein:

Als Güga grappaesken Gesichts die Heilige Flasche herumzieg, frug Jenny, was das denn sei. Amarillo wurt ihr ant: „It makes curly blond hair“. Jenny hat trotzdem einen genommen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: katakura am 2012-11-17, 16:00:41
Es entstand die Idee, fiktive Stadtführungen zu geben, also beliebigen Touristen in beliebigen Sprachen beliebig abstrus-erfundene Informationen abzuverreichen, etwa: "Im Jahr 1569 eheloch Fürst Sigisbold der Saumselige die Prinzessin Hadalind vom Zapfenstreich aber schon dermaßen. Die Trümmer jener Hochzeitsnacht können Sie hier noch sehen."

Weitere Ideen zur betrügerischen Stadtführung entstanden: "Wo heute die Mauer steht, an denen der Wolf und die sieben Geißlein hängen, war früher das Waldstück, wo es passiert ist! Ursprünglich hingen dort die Originalköpfe, bis 1877 wurden sie noch jährlich erneuert. Dann gab es keine Wölfe mehr." Und so weiter, kurz: Fikten, Fikten, Fikten.

... bezulg der herkunft der fiktenreichen stadtführungen gibt es schlechte nachrichten! ... noch wahnen wir perVersen uns im besitz der originären idee zu diesem spaße ... but alas! ...

... just dieser tage las ich "gefühltes wissen" (http://www.amazon.de/Gef%C3%BChltes-Wissen-Horst-Evers/dp/349924294X) (rowohlt TB, 2007) von horst evers und entdak dort zu meiner überraschung auf s. 103 die geschichte "jeder hilft berlin" ... und darin beschreibt evers seine zufällige begegnung mit einem berliner, der an der kreuzung mehringdamm / yorckstraße (http://maps.google.de/maps?oe=utf-8&rls=org.mozilla:de:official&client=firefox-a&channel=np&um=1&ie=UTF-8&q=curry+36&fb=1&gl=de&hq=curry+36&cid=0,0,9581526251791702788&sa=X&ei=uKinULHBNoS1tAaokYHgDA&ved=0CI4BEPwSMAA) (dit is beim curry 36, berlins bekanntester currywurschtbude, wa?!) zwei ahnungslosen touristen im brustton der überzeugung den größten blödsinn über die dort stehenden häuser erzählt ... u.a. habe goebbels in kreuzberg gewohnt (wegen der nähe zum sportpalast, wo er ja immer seine reden gehalten habe) und zwei stock über ihm habe 1873 ein gewisser alfred schiertz die erste heftklammer europas erfunden ... zwei tage später trifft evers in seiner geschichte diesen kundigen "stadtführer" am nollendorfplatz (http://maps.google.de/maps?oe=utf-8&rls=org.mozilla:de:official&client=firefox-a&channel=np&um=1&ie=UTF-8&q=nollendorfplatz&fb=1&gl=de&hq=nollendorfplatz&hnear=nollendorfplatz&cid=0,0,406771706431076796&sa=X&ei=CainUKLuB4XvsgbfmYDYAQ&ved=0CIwBEPwSMAA) wieder, wobei dieser gerade zwei australischen touristen erklärt, dass in einem der eckhäuser magnus stiehl 1865 den radiergummi erfunden habe ... un dit azehlta allet aus daffke - so wie wir es auch vorhatten ...

... ich war durchaus ein wenig perplex, dass wir offensilcht marburgens die idee der fiktiven stadtführungen zum zweiten mal entwalcken haben und horst evers diese schon vor fünf jahren hatte :-[ ...

... angesichts dessen kam mir spontan ephraim kishons klage in den sinn: Es ist schwer, etwas Neues zu erdichten, seit Aristophanes damit angefangen hat, meine Ideen zu stehlen.
Titel: Re: PerVers XV Marburg 2012
Beitrag von: Günter Gans am 2012-11-18, 02:34:27
Mir fällt gerade noch was wichtiges zur Chronik der PerVers in Marburg ein:

Als Güga grappaesken Gesichts die Heilige Flasche herumzieg, frug Jenny, was das denn sei. Amarillo wurt ihr ant: „It makes curly blond hair“. Jenny hat trotzdem einen genommen.

Ja, Hochacht & Abdenhut vor der Unerschröncke der jungen Dame,
@ a) zu erscheinen,
@ b) dies Ereignis auf- und
@ c) das Blondiergetränk einsich{t}zunehmen.